Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
Target3-hydroxy-3-methylglutaryl-coenzyme A reductase
LigandBDBM50321259
Substrate/Competitorn/a
Meas. Tech.ChEMBL_638412
IC50 153000±n/a nM
Citation Argüelles NSánchez-Sandoval EMendieta AVilla-Tanaca LGarduño-Siciliano LJiménez FCruz Mdel CMedina-Franco JLChamorro-Cevallos GTamariz J Design, synthesis, and docking of highly hypolipidemic agents: Schizosaccharomyces pombe as a new model for evaluating alpha-asarone-based HMG-CoA reductase inhibitors. Bioorg Med Chem 18:4238-48 (2010) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
3-hydroxy-3-methylglutaryl-coenzyme A reductase
Name:3-hydroxy-3-methylglutaryl-coenzyme A reductase
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:114890.37
Organism:Schizosaccharomyces pombe
Description:ChEMBL_638412
Residue:1053
Sequence:
MIYKLAARYPIQVIAIVGILVSMAYFSFLEALTQEDFPVLIRALKRFGILDGFPNTRLPN
EMILKLSSVQGEDASVWEQIPAAELGGEGFVDFDITQWYYPANAKVDVAQLVEPYRNDCI
FHDASGACHFFFKEVGNWTVSSIALPSNLANPPIDYFLDSSSTVIQRILPAIREHGISWS
WLLQLIARTWMNTLKIASQASKTELLIVGTAYACMLISIVSLYLKMRRLGSKFWLFFSVL
LSTLFSVQFAMTLVRASGVRISLVSLIESLPFLINVVALDKAAELTRQVITRCSVSDSHS
PMHEDIAKACRNAAPPILRHFSFGIVVLAIFSYCNFGIKQFFLFAAVMIYDLLLLFSFFV
AILTLKLEMRRYNAKDDVRKVLIEEGLSESTARHVADGNDSSATTSAGSRYFKVRYGTKI
ILFIFIAFNLFELCSIPFKHYAATSAAAARLIPLVRSQYPDFKSQRLLDDGVFDDVLSAI
SSMSNIESPSVRLLPAVFYGAELSSTSFLSTIHSFINNWSHYISASFLSKWIVCALSLSI
AVNVFLLNAARLNSIKEEPEKKVVEKVVEVVKYIPSSNSSSIDDIQKDEIAQESVVRSLE
ECITLYNNGQISTLNDEEVVQLTLAKKIPLYALERVLKDVTRAVVIRRTVVSRSSRTKTL
ESSNCPVYHYDYSRVLNACCENVIGYMPLPLGVAGPLIIDGKPFYIPMATTEGALVASTM
RGCKAINAGGGAVTVLTRDQMSRGPCVAFPNLTRAGRAKIWLDSPEGQEVMKKAFNSTSR
FARLQHIKTALAGTRLFIRFCTSTGDAMGMNMISKGVEHALVVMSNDAGFDDMQVISVSG
NYCTDKKPAAINWIDGRGKSVIAEAIIPGDAVKSVLKTTVEDLVKLNVDKNLIGSAMAGS
VGGFNAHAANIVTAVYLATGQDPAQNVESSNCITLMDNVDGNLQLSVSMPSIEVGTIGGG
TVLEPQGAMLDLLGVRGAHMTSPGDNSRQLARVVAAAVMAGELSLCSALASGHLVKSHIG
LNRSALNTPAMDSSAKKPATDALKSVNSRVPGR
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50321259
n/a
NameBDBM50321259
Synonyms:1-(2-amino-4,5-dimethoxyphenyl)propan-1-ol | CHEMBL1165439
TypeSmall organic molecule
Emp. Form.C11H17NO3
Mol. Mass.211.2576
SMILESCCC(O)c1cc(OC)c(OC)cc1N
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: