Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetFalcipain-2
LigandBDBM50322346
Substrate/Competitorn/a
Meas. Tech.ChEMBL_642736
Ki 3480±n/a nM
Citation Bova FEttari RMicale NCarnovale CSchirmeister TGelhaus CLeippe MGrasso SZappalà M Constrained peptidomimetics as antiplasmodial falcipain-2 inhibitors. Bioorg Med Chem 18:4928-38 (2010) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Falcipain-2
Name:Falcipain 2
Synonyms:Cysteine protease falcipain-2 | Falcipain 2
Type:Enzyme
Mol. Mass.:55912.60
Organism:Plasmodium falciparum
Description:Recombinant falcipain-2.
Residue:484
Sequence:
MDYNMDYAPHEVISQQGERFVDKYVDRKILKNKKSLLVIISLSVLSVVGFVLFYFTPNSR
KSDLFKNSSVENNNDDYIINSLLKSPNGKKFIVSKIDEALSFYDSKKNDINKYNEGNNNN
NADFKGLSLFKENTPSNNFIHNKDYFINFFDNKFLMNNAEHINQFYMFIKTNNKQYNSPN
EMKERFQVFLQNAHKVNMHNNNKNSLYKKELNRFADLTYHEFKNKYLSLRSSKPLKNSKY
LLDQMNYEEVIKKYRGEENFDHAAYDWRLHSGVTPVKDQKNCGSCWAFSSIGSVESQYAI
RKNKLITLSEQELVDCSFKNYGCNGGLINNAFEDMIELGGICPDGDYPYVSDAPNLCNID
RCTEKYGIKNYLSVPDNKLKEALRFLGPISISVAVSDDFAFYKEGIFDGECGDQLNHAVM
LVGFGMKEIVNPLTKKGEKHYYYIIKNSWGQQWGERGFINIETDESGLMRKCGLGTDAFI
PLIE
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50322346
n/a
NameBDBM50322346
Synonyms:(R)-Methyl4-(2-(3-((naphthalen-1-ylcarbamoyloxy)methyl)-2-oxo-5-phenyl-2,3-dihydro-1H-benzo[e][1,4]diazepin-1-yl)acetamido)but-2-enoate | CHEMBL1171636
TypeSmall organic molecule
Emp. Form.C34H30N4O6
Mol. Mass.590.6252
SMILESCOC(=O)\C=C\CNC(=O)CN1c2ccccc2C(=N[C@H](COC(=O)Nc2cccc3ccccc23)C1=O)c1ccccc1 |r,c:19|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: