Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetNeuronal acetylcholine receptor subunit alpha-7
LigandBDBM50166908
Substrate/Competitorn/a
Meas. Tech.ChEMBL_645075
Ki 125±n/a nM
Citation Lowe JADeNinno SLCoe JWZhang LMente SHurst RSMather RJWard KMShrikhande ARollema HJohnson DEHorner WGorczyca RTingley FDKozak RMajchrzak MJTritto TSadlier JShaffer CLEllerbrock BOsgood SMMacDougall MCMcDowell LL A novel series of [3.2.1] azabicyclic biaryl ethers as alpha3beta4 and alpha6/4beta4 nicotinic receptor agonists. Bioorg Med Chem Lett 20:4749-52 (2010) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Neuronal acetylcholine receptor subunit alpha-7
Name:Neuronal acetylcholine receptor subunit alpha-7
Synonyms:CHRNA7 | Cholinergic, Nicotinic Alpha7 | NACHRA7 | Neuronal acetylcholine receptor protein alpha-7 subunit | Neuronal acetylcholine receptor subunit alpha-7 (nAChR-alpha 7) | Nicotinic acetylcholine receptor alpha-7 (alpha7 nAChR)
Type:n/a
Mol. Mass.:56448.33
Organism:Homo sapiens (Human)
Description: CHRNA7 (NACHRA7)
Residue:502
Sequence:
MRCSPGGVWLALAASLLHVSLQGEFQRKLYKELVKNYNPLERPVANDSQPLTVYFSLSLL
QIMDVDEKNQVLTTNIWLQMSWTDHYLQWNVSEYPGVKTVRFPDGQIWKPDILLYNSADE
RFDATFHTNVLVNSSGHCQYLPPGIFKSSCYIDVRWFPFDVQHCKLKFGSWSYGGWSLDL
QMQEADISGYIPNGEWDLVGIPGKRSERFYECCKEPYPDVTFTVTMRRRTLYYGLNLLIP
CVLISALALLVFLLPADSGEKISLGITVLLSLTVFMLLVAEIMPATSDSVPLIAQYFAST
MIIVGLSVVVTVIVLQYHHHDPDGGKMPKWTRVILLNWCAWFLRMKRPGEDKVRPACQHK
QRRCSLASVEMSAVAPPPASNGNLLYIGFRGLDGVHCVPTPDSGVVCGRMACSPTHDEHL
LHGGQPPEGDPDLAKILEEVRYIANRFRCQDESEAVCSEWKFAACVVDRLCLMAFSVFTI
ICTIGILMSAPNFVEAVSKDFA
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50166908
n/a
NameBDBM50166908
Synonyms:5,8,14-triazatetracyclo[10.3.1.02,11.04,9]hexadeca-2(11),3,5,7,9-pentaene; dihydrochloride | CHEMBL556954 | VARENICLINE
TypeSmall organic molecule
Emp. Form.C13H13N3
Mol. Mass.211.2624
SMILESC1C2CNCC1c1cc3nccnc3cc21
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: