Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCarbonic anhydrase 1
LigandBDBM50146462
Substrate/Competitorn/a
Meas. Tech.ChEMBL_651943
Ki 3100±n/a nM
Citation Innocenti AGülçin IScozzafava ASupuran CT Carbonic anhydrase inhibitors. Antioxidant polyphenols effectively inhibit mammalian isoforms I-XV. Bioorg Med Chem Lett 20:5050-3 (2010) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Carbonic anhydrase 1
Name:Carbonic anhydrase
Synonyms:CA-I | CAB | Carbonate dehydratase I | Carbonic anhydrase 1 (CA I) | Carbonic anhydrase 1 (CA-I) | Carbonic anhydrase 1 (Recombinant CA I) | Carbonic anhydrase 2 (CA II) | Carbonic anhydrase B | Carbonic anhydrase I (CA I) | Carbonic anhydrase I (CA-I) | Carbonic anhydrase I (CAI) | Carbonic anhydrase I (hCA I) | Carbonic anhydrase isoenzyme I (hCA I) | hCA
Type:Enzyme
Mol. Mass.:28873.37
Organism:Homo sapiens (Human)
Description:P00915
Residue:261
Sequence:
MASPDWGYDDKNGPEQWSKLYPIANGNNQSPVDIKTSETKHDTSLKPISVSYNPATAKEI
INVGHSFHVNFEDNDNRSVLKGGPFSDSYRLFQFHFHWGSTNEHGSEHTVDGVKYSAELH
VAHWNSAKYSSLAEAASKADGLAVIGVLMKVGEANPKLQKVLDALQAIKTKGKRAPFTNF
DPSTLLPSSLDFWTYPGSLTHPPLYESVTWIICKESISVSSEQLAQFRSLLSNVEGDNAV
PMQHNNRPTQPLKGRTVRASF
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50146462
n/a
NameBDBM50146462
Synonyms:(2E)-3-(2-hydroxyphenyl)-2-propenoic acid | (2E)-3-(2-hydroxyphenyl)prop-2-enoic acid | (2E)-3-(2-hydroxyphenyl)prop-2-enoic acid (7) | (E)-2-hydroxycinnamic acid | (E)-3-(2-hydroxyphenyl)-2-propenoic acid | (E)-o-hydroxycinnamic acid | CHEMBL52564 | o-Hydroxycinnamic acid (o-HCA) | o-hydroxy-trans-cinnamic acid | trans-2-coumaric acid | trans-o-hydroxycinnamic acid
TypeSmall organic molecule
Emp. Form.C9H8O3
Mol. Mass.164.158
SMILESOC(=O)\C=C\c1ccccc1O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: