Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCarbonic Anhydrase VA
LigandBDBM23416
Substrate/Competitorn/a
Meas. Tech.ChEMBL_651947
Ki 4210±n/a nM
Citation Innocenti AGülçin IScozzafava ASupuran CT Carbonic anhydrase inhibitors. Antioxidant polyphenols effectively inhibit mammalian isoforms I-XV. Bioorg Med Chem Lett 20:5050-3 (2010) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Carbonic Anhydrase VA
Name:Carbonic anhydrase V
Synonyms:CA-VA | Carbonate dehydratase VA | Carbonic anhydrase 5A (CA VA) | Carbonic anhydrase 5A, mitochondrial | Carbonic anhydrase 5A, mitochondrial precursor | Carbonic anhydrase VA (CA VA)
Type:Enzyme
Mol. Mass.:34755.54
Organism:Homo sapiens (Human)
Description:Human (cloned) isozyme
Residue:305
Sequence:
MLGRNTWKTSAFSFLVEQMWAPLWSRSMRPGRWCSQRSCAWQTSNNTLHPLWTVPVSVPG
GTRQSPINIQWRDSVYDPQLKPLRVSYEAASCLYIWNTGYLFQVEFDDATEASGISGGPL
ENHYRLKQFHFHWGAVNEGGSEHTVDGHAYPAELHLVHWNSVKYQNYKEAVVGENGLAVI
GVFLKLGAHHQTLQRLVDILPEIKHKDARAAMRPFDPSTLLPTCWDYWTYAGSLTTPPLT
ESVTWIIQKEPVEVAPSQLSAFRTLLFSALGEEEKMMVNNYRPLQPLMNRKVWASFQATN
EGTRS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM23416
n/a
NameBDBM23416
Synonyms:α-CA inhibitor, 3 | (+)-Catechin | (2R,3S)-2-(3,4-dihydroxyphenyl)-3,4-dihydro-2H-1-benzopyran-3,5,7-triol | CHEMBL311498 | Catechin | D-Catechin
TypeFlavonol
Emp. Form.C15H14O6
Mol. Mass.290.2681
SMILESO[C@H]1Cc2c(O)cc(O)cc2O[C@@H]1c1ccc(O)c(O)c1 |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: