Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCarbonic anhydrase 6 (CA-VI)
LigandBDBM50325274
Substrate/Competitorn/a
Meas. Tech.ChEMBL_651949
Ki 9470±n/a nM
Citation Innocenti AGülçin IScozzafava ASupuran CT Carbonic anhydrase inhibitors. Antioxidant polyphenols effectively inhibit mammalian isoforms I-XV. Bioorg Med Chem Lett 20:5050-3 (2010) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Carbonic anhydrase 6 (CA-VI)
Name:Carbonic anhydrase 6 (CA-VI)
Synonyms:CA-VI | Carbonate dehydratase VI | Carbonic Anhydrase VI | Carbonic anhydrase 6 | Carbonic anhydrase 6 (CA VI) | Carbonic anhydrase VI (CA VI) | Salivary carbonic anhydrase | Secreted carbonic anhydrase
Type:Enzyme
Mol. Mass.:35371.40
Organism:Homo sapiens (Human)
Description:P23280
Residue:308
Sequence:
MRALVLLLSLFLLGGQAQHVSDWTYSEGALDEAHWPQHYPACGGQRQSPINLQRTKVRYN
PSLKGLNMTGYETQAGEFPMVNNGHTVQISLPSTMRMTVADGTVYIAQQMHFHWGGASSE
ISGSEHTVDGIRHVIEIHIVHYNSKYKSYDIAQDAPDGLAVLAAFVEVKNYPENTYYSNF
ISHLANIKYPGQRTTLTGLDVQDMLPRNLQHYYTYHGSLTTPPCTENVHWFVLADFVKLS
RTQVWKLENSLLDHRNKTIHNDYRRTQPLNHRVVESNFPNQEYTLGSEFQFYLHKIEEIL
DYLRRALN
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50325274
n/a
NameBDBM50325274
Synonyms:4-{2-[3-(4-Hydroxy-phenyl)-1-methyl-propylamino]-ethyl}-benzene-1,2-diol | 4-{2-[3-(4-Hydroxy-phenyl)-1-methyl-propylamino]-ethyl}-benzene-1,2-diol(Dobutamine) | CHEMBL926 | DOBUTAMINE | Dobutrex | cid_36811
TypeSmall organic molecule
Emp. Form.C18H23NO3
Mol. Mass.301.3801
SMILESCC(CCc1ccc(O)cc1)NCCc1ccc(O)c(O)c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: