Reaction Details |
| Report a problem with these data |
Target | Cyclin-dependent kinase 5 |
---|
Ligand | BDBM5718 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_660570 (CHEMBL1250278) |
---|
IC50 | 3000±n/a nM |
---|
Citation | Sridhar, J; Akula, N; Pattabiraman, N Selectivity and potency of cyclin-dependent kinase inhibitors. AAPS J8:204-21 (2006) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Cyclin-dependent kinase 5 |
---|
Name: | Cyclin-dependent kinase 5 |
Synonyms: | CDK5 | CDK5_HUMAN | CDKN5 | Cell division protein kinase 5 | Cyclin-dependent kinase 5 (CDK5/ p25) | Cyclin-dependent kinase 5 (CDK5/p35) | Cyclin-dependent-like kinase 5 | Cyclin-dependent-like kinase 5 (CDK5) | PSSALRE | Serine/threonine-protein kinase PSSALRE | Tau protein kinase II catalytic subunit |
Type: | Enzyme Subunit |
Mol. Mass.: | 33308.61 |
Organism: | Homo sapiens (Human) |
Description: | n/a |
Residue: | 292 |
Sequence: | MQKYEKLEKIGEGTYGTVFKAKNRETHEIVALKRVRLDDDDEGVPSSALREICLLKELKH
KNIVRLHDVLHSDKKLTLVFEFCDQDLKKYFDSCNGDLDPEIVKSFLFQLLKGLGFCHSR
NVLHRDLKPQNLLINRNGELKLADFGLARAFGIPVRCYSAEVVTLWYRPPDVLFGAKLYS
TSIDMWSAGCIFAELANAGRPLFPGNDVDDQLKRIFRLLGTPTEEQWPSMTKLPDYKPYP
MYPATTSLVNVVPKLNATGRDLLQNLLKCNPVQRISAEEALQHPYFSDFCPP
|
|
|
BDBM5718 |
---|
n/a |
---|
Name | BDBM5718 |
Synonyms: | 2,6,9-Trisubstituted purine deriv. 26 | 2-{[6-(benzylamino)-9-methyl-9H-purin-2-yl]amino}ethan-1-ol | 2-{[6-(benzylamino)-9-methyl-9H-purin-2-yl]amino}ethanol | 6-(benzylamino)-2-[(2-hydroxyethyl)amino]-9-methylpurine | CHEMBL280074 | Olomoucine | purine deriv. 5 |
Type | Small organic molecule |
Emp. Form. | C15H18N6O |
Mol. Mass. | 298.343 |
SMILES | Cn1cnc2c(NCc3ccccc3)nc(NCCO)nc12 |
Structure |
|