| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Galectin-7 |
|---|
| Ligand | BDBM50326601 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_661836 (CHEMBL1252152) |
|---|
| Kd | >5000000±n/a nM |
|---|
| Citation |  Salameh, BA; Cumpstey, I; Sundin, A; Leffler, H; Nilsson, UJ 1H-1,2,3-triazol-1-yl thiodigalactoside derivatives as high affinity galectin-3 inhibitors. Bioorg Med Chem18:5367-78 (2010) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Galectin-7 |
|---|
| Name: | Galectin-7 |
|---|
| Synonyms: | Gal-7 | HKL-14 | LEG7_HUMAN | LGALS7 | PI7 | PIG1 | p53-induced gene 1 protein |
|---|
| Type: | Galactoside-binding protein |
|---|
| Mol. Mass.: | 15077.89 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | n/a |
|---|
| Residue: | 136 |
|---|
| Sequence: | MSNVPHKSSLPEGIRPGTVLRIRGLVPPNASRFHVNLLCGEEQGSDAALHFNPRLDTSEV
VFNSKEQGSWGREERGPGVPFQRGQPFEVLIIASDDGFKAVVGDAQYHHFRHRLPLARVR
LVEVGGDVQLDSVRIF
|
|
|
|---|
| BDBM50326601 |
|---|
| n/a |
|---|
| Name | BDBM50326601 |
|---|
| Synonyms: | CHEMBL1254521 | Methyl-3-deoxy-3-(4-(1-hydroxycyclohexyl)-1H-[1,2,3]-triazol-1-yl)-1-thio-beta-D-galactopyranoside |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C15H25N3O5S |
|---|
| Mol. Mass. | 359.441 |
|---|
| SMILES | CS[C@@H]1O[C@H](CO)[C@H](O)[C@@H]([C@H]1O)n1cc(nn1)C1(O)CCCCC1 |r| |
|---|
| Structure | 
|
|---|
Search and Browse
