| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Translocator protein |
|---|
| Ligand | BDBM50060095 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_702766 (CHEMBL1655209) |
|---|
| Ki | 0.5±n/a nM |
|---|
| Citation |  Pike, VW; Taliani, S; Lohith, TG; Owen, DR; Pugliesi, I; Da Pozzo, E; Hong, J; Zoghbi, SS; Gunn, RN; Parker, CA; Rabiner, EA; Fujita, M; Innis, RB; Martini, C; Da Settimo, F Evaluation of novel N1-methyl-2-phenylindol-3-ylglyoxylamides as a new chemotype of 18 kDa translocator protein-selective ligand suitable for the development of positron emission tomography radioligands. J Med Chem54:366-73 (2011) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Translocator protein |
|---|
| Name: | Translocator protein |
|---|
| Synonyms: | Benzodiazepine receptors; peripheral & central | Bzrp | Mbr | Mitochondrial benzodiazepine receptor | PBR | PKBS | Peripheral benzodiazepine receptor (PBR) | Peripheral-Type Benzodiazepine Receptor | TSPO_RAT | Tspo |
|---|
| Type: | Mitochondrion membrane protein |
|---|
| Mol. Mass.: | 18945.84 |
|---|
| Organism: | Rattus norvegicus (rat) |
|---|
| Description: | Competitive binding experiments were performed on rat kidney mitochondrial membranes. |
|---|
| Residue: | 169 |
|---|
| Sequence: | MSQSWVPAVGLTLVPSLGGFMGAYFVRGEGLRWYASLQKPSWHPPRWTLAPIWGTLYSAM
GYGSYIIWKELGGFTEEAMVPLGLYTGQLALNWAWPPIFFGARQMGWALVDLMLVSGVAT
ATTLAWHRVSPPAARLLYPYLAWLAFATMLNYYVWRDNSGRRGGSRLTE
|
|
|
|---|
| BDBM50060095 |
|---|
| n/a |
|---|
| Name | BDBM50060095 |
|---|
| Synonyms: | 2-[6,8-Dichloro-2-(4-chloro-phenyl)-imidazo[1,2-a]pyridin-3-yl]-N,N-dipropyl-acetamide | CHEMBL432608 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C21H22Cl3N3O |
|---|
| Mol. Mass. | 438.778 |
|---|
| SMILES | CCCN(CCC)C(=O)Cc1c(nc2c(Cl)cc(Cl)cn12)-c1ccc(Cl)cc1 |
|---|
| Structure | 
|
|---|
Search and Browse
