Reaction Details |
| Report a problem with these data |
Target | Translocator protein |
---|
Ligand | BDBM50143223 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_702767 (CHEMBL1655210) |
---|
Ki | 12.2±n/a nM |
---|
Citation | Pike, VW; Taliani, S; Lohith, TG; Owen, DR; Pugliesi, I; Da Pozzo, E; Hong, J; Zoghbi, SS; Gunn, RN; Parker, CA; Rabiner, EA; Fujita, M; Innis, RB; Martini, C; Da Settimo, F Evaluation of novel N1-methyl-2-phenylindol-3-ylglyoxylamides as a new chemotype of 18 kDa translocator protein-selective ligand suitable for the development of positron emission tomography radioligands. J Med Chem54:366-73 (2011) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Translocator protein |
---|
Name: | Translocator protein |
Synonyms: | Benzodiazepine receptors; peripheral & central | Bzrp | Mbr | Mitochondrial benzodiazepine receptor | PBR | PKBS | Peripheral benzodiazepine receptor (PBR) | Peripheral-Type Benzodiazepine Receptor | TSPO_RAT | Tspo |
Type: | Mitochondrion membrane protein |
Mol. Mass.: | 18945.84 |
Organism: | Rattus norvegicus (rat) |
Description: | Competitive binding experiments were performed on rat kidney mitochondrial membranes. |
Residue: | 169 |
Sequence: | MSQSWVPAVGLTLVPSLGGFMGAYFVRGEGLRWYASLQKPSWHPPRWTLAPIWGTLYSAM
GYGSYIIWKELGGFTEEAMVPLGLYTGQLALNWAWPPIFFGARQMGWALVDLMLVSGVAT
ATTLAWHRVSPPAARLLYPYLAWLAFATMLNYYVWRDNSGRRGGSRLTE
|
|
|
BDBM50143223 |
---|
n/a |
---|
Name | BDBM50143223 |
Synonyms: | 2-Oxo-2-(2-phenyl-1H-indol-3-yl)-N,N-dipropyl-acetamide | 2-oxo-2-(2-phenyl-1H-indol-3-yl)-N,N-dipropylacetamide | CHEMBL56058 |
Type | Small organic molecule |
Emp. Form. | C22H24N2O2 |
Mol. Mass. | 348.4382 |
SMILES | CCCN(CCC)C(=O)C(=O)c1c([nH]c2ccccc12)-c1ccccc1 |
Structure |
|