| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Translocator protein |
|---|
| Ligand | BDBM50335270 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_702771 (CHEMBL1655214) |
|---|
| Ki | 1.57±n/a nM |
|---|
| Citation |  Pike, VW; Taliani, S; Lohith, TG; Owen, DR; Pugliesi, I; Da Pozzo, E; Hong, J; Zoghbi, SS; Gunn, RN; Parker, CA; Rabiner, EA; Fujita, M; Innis, RB; Martini, C; Da Settimo, F Evaluation of novel N1-methyl-2-phenylindol-3-ylglyoxylamides as a new chemotype of 18 kDa translocator protein-selective ligand suitable for the development of positron emission tomography radioligands. J Med Chem54:366-73 (2011) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Translocator protein |
|---|
| Name: | Translocator protein |
|---|
| Synonyms: | BZRP | MBR | Mitochondrial benzodiazepine receptor | PBR | PKBS | Peripheral benzodiazepine receptor-related protein | Peripheral-type benzodiazepine receptor | TSPO | TSPO_HUMAN |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 18834.74 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P30536 |
|---|
| Residue: | 169 |
|---|
| Sequence: | MAPPWVPAMGFTLAPSLGCFVGSRFVHGEGLRWYAGLQKPSWHPPHWVLGPVWGTLYSAM
GYGSYLVWKELGGFTEKAVVPLGLYTGQLALNWAWPPIFFGARQMGWALVDLLLVSGAAA
ATTVAWYQVSPLAARLLYPYLAWLAFTTTLNYCVWRDNHGWRGGRRLPE
|
|
|
|---|
| BDBM50335270 |
|---|
| n/a |
|---|
| Name | BDBM50335270 |
|---|
| Synonyms: | 2-(1-methyl-2-(4-nitrophenyl)-1H-indol-3-yl)-2-oxo-N,N-dipropylacetamide | CHEMBL1651236 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C23H25N3O4 |
|---|
| Mol. Mass. | 407.4623 |
|---|
| SMILES | CCCN(CCC)C(=O)C(=O)c1c(-c2ccc(cc2)[N+]([O-])=O)n(C)c2ccccc12 |
|---|
| Structure | 
|
|---|
Search and Browse
