Reaction Details |
| Report a problem with these data |
Target | Dihydrofolate reductase |
---|
Ligand | BDBM50335532 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_710363 (CHEMBL1653324) |
---|
IC50 | 96±n/a nM |
---|
Citation | Bourne, CR; Bunce, RA; Bourne, PC; Berlin, KD; Barrow, EW; Barrow, WW Crystal structure of Bacillus anthracis dihydrofolate reductase with the dihydrophthalazine-based trimethoprim derivative RAB1 provides a structural explanation of potency and selectivity. Antimicrob Agents Chemother53:3065-73 (2009) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Dihydrofolate reductase |
---|
Name: | Dihydrofolate reductase |
Synonyms: | Dihydrofolate Reductase (DHFR) | baDHFR |
Type: | Enzyme |
Mol. Mass.: | 19120.62 |
Organism: | Bacillus anthracis |
Description: | baDHFR was expressed in E. coli BL21, and purified to homogeneity. |
Residue: | 162 |
Sequence: | MIVSFMVAMDENRVIGKDNNLPWRLPSELQYVKKTTMGHPLIMGRKNYEAIGRPLPGRRN
IIVTRNEGYHVEGCEVAHSVEEVFELCKNEEEIFIFGGAQIYDLFLPYVDKLYITKIHHA
FEGDTFFPEMDMTNWKEVFVEKGLTDEKNPYTYYYHVYEKQQ
|
|
|
BDBM50335532 |
---|
n/a |
---|
Name | BDBM50335532 |
Synonyms: | (E)-3-(5-((2,4-diaminopyrimidin-5-yl)methyl)-2,3-dimethoxyphenyl)-1-(1-ethylphthalazin-2(1H)-yl)prop-2-en-1-one | CHEMBL1652303 |
Type | Small organic molecule |
Emp. Form. | C26H28N6O3 |
Mol. Mass. | 472.5389 |
SMILES | CC[C@@H]1N(N=Cc2ccccc12)C(=O)\C=C\c1cc(Cc2cnc(N)nc2N)cc(OC)c1OC |r,c:4| |
Structure |
|