| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Dihydrofolate Reductase (DHFR) |
|---|
| Ligand | BDBM18050 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_710363 |
|---|
| IC50 | 15±n/a nM |
|---|
| Citation |  Bourne CR; Bunce RA; Bourne PC; Berlin KD; Barrow EW; Barrow WW Crystal structure of Bacillus anthracis dihydrofolate reductase with the dihydrophthalazine-based trimethoprim derivative RAB1 provides a structural explanation of potency and selectivity. Antimicrob Agents Chemother 53:3065-73 (2009) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Dihydrofolate Reductase (DHFR) |
|---|
| Name: | Dihydrofolate Reductase (DHFR) |
|---|
| Synonyms: | baDHFR |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 19120.62 |
|---|
| Organism: | Bacillus anthracis |
|---|
| Description: | baDHFR was expressed in E. coli BL21, and purified to homogeneity. |
|---|
| Residue: | 162 |
|---|
| Sequence: | MIVSFMVAMDENRVIGKDNNLPWRLPSELQYVKKTTMGHPLIMGRKNYEAIGRPLPGRRN
IIVTRNEGYHVEGCEVAHSVEEVFELCKNEEEIFIFGGAQIYDLFLPYVDKLYITKIHHA
FEGDTFFPEMDMTNWKEVFVEKGLTDEKNPYTYYYHVYEKQQ
|
|
|
|---|
| BDBM18050 |
|---|
| n/a |
|---|
| Name | BDBM18050 |
|---|
| Synonyms: | 2-[(4-{[(2,4-diaminopteridin-6-yl)methyl](methyl)amino}phenyl)formamido]pentanedioic acid | CHEMBL34259 | METHOTREXATE | MTX | Methotrexate | cid_126941 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C20H22N8O5 |
|---|
| Mol. Mass. | 454.4393 |
|---|
| SMILES | CN(Cc1cnc2nc(N)nc(N)c2n1)c1ccc(cc1)C(=O)N[C@@H](CCC(O)=O)C(O)=O |r| |
|---|
| Structure | 
|
|---|
Search and Browse
