| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Steroid hormone receptor ERR1 |
|---|
| Ligand | BDBM50336732 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_718275 (CHEMBL1679579) |
|---|
| IC50 | 470±n/a nM |
|---|
| Citation |  Patch, RJ; Searle, LL; Kim, AJ; De, D; Zhu, X; Askari, HB; O'Neill, JC; Abad, MC; Rentzeperis, D; Liu, J; Kemmerer, M; Lin, L; Kasturi, J; Geisler, JG; Lenhard, JM; Player, MR; Gaul, MD Identification of diaryl ether-based ligands for estrogen-related receptora as potential antidiabetic agents. J Med Chem54:788-808 (2012) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Steroid hormone receptor ERR1 |
|---|
| Name: | Steroid hormone receptor ERR1 |
|---|
| Synonyms: | ERR-alpha | ERR1 | ERR1_HUMAN | ESRL1 | ESRRA | Estrogen receptor-like 1 | Estrogen-Related Receptor, alpha | Estrogen-related receptor alpha | NR3B1 | Nuclear receptor subfamily 3 group B member 1 | Steroid hormone receptor ERR1 | Steroid hormone receptor ERR1 alpha | Steroid hormone receptor ERR1/Estrogen-related receptor alpha (ERRa) | von Hippel-Lindau disease tumor suppressor/Steroid hormone receptor ERR1 |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 45508.08 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | ChEMBL_1499891 |
|---|
| Residue: | 423 |
|---|
| Sequence: | MSSQVVGIEPLYIKAEPASPDSPKGSSETETEPPVALAPGPAPTRCLPGHKEEEDGEGAG
PGEQGGGKLVLSSLPKRLCLVCGDVASGYHYGVASCEACKAFFKRTIQGSIEYSCPASNE
CEITKRRRKACQACRFTKCLRVGMLKEGVRLDRVRGGRQKYKRRPEVDPLPFPGPFPAGP
LAVAGGPRKTAAPVNALVSHLLVVEPEKLYAMPDPAGPDGHLPAVATLCDLFDREIVVTI
SWAKSIPGFSSLSLSDQMSVLQSVWMEVLVLGVAQRSLPLQDELAFAEDLVLDEEGARAA
GLGELGAALLQLVRRLQALRLEREEYVLLKALALANSDSVHIEDAEAVEQLREALHEALL
EYEAGRAGPGGGAERRRAGRLLLTLPLLRQTAGKVLAHFYGVKLEGKVPMHKLFLEMLEA
MMD
|
|
|
|---|
| BDBM50336732 |
|---|
| n/a |
|---|
| Name | BDBM50336732 |
|---|
| Synonyms: | 4-[4-(2,4-Dioxothiazolidin-5-ylidenemethyl)-2-methoxyphenoxy]-2-trifluoromethylbenzonitrile | CHEMBL1671975 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C19H11F3N2O4S |
|---|
| Mol. Mass. | 420.362 |
|---|
| SMILES | COc1cc(C=C2SC(O)=NC2=O)ccc1Oc1ccc(C#N)c(c1)C(F)(F)F |w:5.4,c:9| |
|---|
| Structure | 
|
|---|
Search and Browse
