Reaction Details |
| Report a problem with these data |
Target | Steroid hormone receptor ERR1 |
---|
Ligand | BDBM22420 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_718350 (CHEMBL1679770) |
---|
IC50 | 190±n/a nM |
---|
Citation | Patch, RJ; Searle, LL; Kim, AJ; De, D; Zhu, X; Askari, HB; O'Neill, JC; Abad, MC; Rentzeperis, D; Liu, J; Kemmerer, M; Lin, L; Kasturi, J; Geisler, JG; Lenhard, JM; Player, MR; Gaul, MD Identification of diaryl ether-based ligands for estrogen-related receptora as potential antidiabetic agents. J Med Chem54:788-808 (2012) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Steroid hormone receptor ERR1 |
---|
Name: | Steroid hormone receptor ERR1 |
Synonyms: | ERR-alpha | ERR1 | ERR1_HUMAN | ESRL1 | ESRRA | Estrogen receptor-like 1 | Estrogen-Related Receptor, alpha | Estrogen-related receptor alpha | NR3B1 | Nuclear receptor subfamily 3 group B member 1 | Steroid hormone receptor ERR1 | Steroid hormone receptor ERR1 alpha | Steroid hormone receptor ERR1/Estrogen-related receptor alpha (ERRa) | von Hippel-Lindau disease tumor suppressor/Steroid hormone receptor ERR1 |
Type: | PROTEIN |
Mol. Mass.: | 45508.08 |
Organism: | Homo sapiens (Human) |
Description: | ChEMBL_1499891 |
Residue: | 423 |
Sequence: | MSSQVVGIEPLYIKAEPASPDSPKGSSETETEPPVALAPGPAPTRCLPGHKEEEDGEGAG
PGEQGGGKLVLSSLPKRLCLVCGDVASGYHYGVASCEACKAFFKRTIQGSIEYSCPASNE
CEITKRRRKACQACRFTKCLRVGMLKEGVRLDRVRGGRQKYKRRPEVDPLPFPGPFPAGP
LAVAGGPRKTAAPVNALVSHLLVVEPEKLYAMPDPAGPDGHLPAVATLCDLFDREIVVTI
SWAKSIPGFSSLSLSDQMSVLQSVWMEVLVLGVAQRSLPLQDELAFAEDLVLDEEGARAA
GLGELGAALLQLVRRLQALRLEREEYVLLKALALANSDSVHIEDAEAVEQLREALHEALL
EYEAGRAGPGGGAERRRAGRLLLTLPLLRQTAGKVLAHFYGVKLEGKVPMHKLFLEMLEA
MMD
|
|
|
BDBM22420 |
---|
n/a |
---|
Name | BDBM22420 |
Synonyms: | (cyclohexylmethyl)({[1-(4-methylphenyl)-1H-indol-3-yl]methyl})amine | Indole compound 1a | Inverse agonist |
Type | Small organic molecule |
Emp. Form. | C23H28N2 |
Mol. Mass. | 332.4818 |
SMILES | Cc1ccc(cc1)-n1cc(CNCC2CCCCC2)c2ccccc12 |
Structure |
|