Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetPyrimidinergic receptor P2Y6
LigandBDBM50227020
Substrate/Competitorn/a
Meas. Tech.ChEMBL_718670
IC50>10000±n/a nM
Citation Baqi YHausmann RRosefort CRettinger JSchmalzing GMüller CE Discovery of potent competitive antagonists and positive modulators of the P2X2 receptor. J Med Chem 54:817-30 (2012) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Pyrimidinergic receptor P2Y6
Name:Pyrimidinergic receptor P2Y6
Synonyms:P2Y purinoceptor 6 | P2Y6
Type:PROTEIN
Mol. Mass.:36452.29
Organism:Homo sapiens (Human)
Description:ChEMBL_1511151
Residue:328
Sequence:
MEWDNGTGQALGLPPTTCVYRENFKQLLLPPVYSAVLAAGLPLNICVITQICTSRRALTR
TAVYTLNLALADLLYACSLPLLIYNYAQGDHWPFGDFACRLVRFLFYANLHGSILFLTCI
SFQRYLGICHPLAPWHKRGGRRAAWLVCVAVWLAVTTQCLPTAIFAATGIQRNRTVCYDL
SPPALATHYMPYGMALTVIGFLLPFAALLACYCLLACRLCRQDGPAEPVAQERRGKAARM
AVVVAAAFAISFLPFHITKTAYLAVRSTPGVPCTVLEAFAAAYKGTRPFASANSVLDPIL
FYFTQKKFRRRPHELLQKLTAKWQRQGR
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50227020
n/a
NameBDBM50227020
Synonyms:CHEMBL271672 | sodium 1-amino-4-(3-chlorophenylamino)-9,10-dioxo-9,10-dihydroanthracene-2-sulfonate
TypeSmall organic molecule
Emp. Form.C20H12ClN2O5S
Mol. Mass.427.838
SMILESNc1c(cc(Nc2cccc(Cl)c2)c2C(=O)c3ccccc3C(=O)c12)S([O-])(=O)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: