Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetMuscarinic acetylcholine receptor M1
LigandBDBM50345692
Substrate/Competitorn/a
Meas. Tech.ChEMBL_750514
Ki 0.38±n/a nM
Citation Lainé DIWan ZYan HZhu CXie HFu WBusch-Petersen JNeipp CDavis RWiddowson KLBlaney FEFoley JBacon AMWebb EFLuttmann MABurman MSarau HMSalmon MPalovich MRBelmonte K Design, synthesis, and structure-activity relationship of tropane muscarinic acetylcholine receptor antagonists. J Med Chem 52:5241-52 (2010) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Muscarinic acetylcholine receptor M1
Name:Muscarinic acetylcholine receptor M1 and M3
Synonyms:CHRM1 | Cholinergic receptor, muscarinic 1 | Cholinergic, muscarinic M1
Type:Protein
Mol. Mass.:51442.54
Organism:Homo sapiens (Human)
Description:P11229
Residue:460
Sequence:
MNTSAPPAVSPNITVLAPGKGPWQVAFIGITTGLLSLATVTGNLLVLISFKVNTELKTVN
NYFLLSLACADLIIGTFSMNLYTTYLLMGHWALGTLACDLWLALDYVASNASVMNLLLIS
FDRYFSVTRPLSYRAKRTPRRAALMIGLAWLVSFVLWAPAILFWQYLVGERTVLAGQCYI
QFLSQPIITFGTAMAAFYLPVTVMCTLYWRIYRETENRARELAALQGSETPGKGGGSSSS
SERSQPGAEGSPETPPGRCCRCCRAPRLLQAYSWKEEEEEDEGSMESLTSSEGEEPGSEV
VIKMPMVDPEAQAPTKQPPRSSPNTVKRPTKKGRDRAGKGQKPRGKEQLAKRKTFSLVKE
KKAARTLSAILLAFILTWTPYNIMVLVSTFCKDCVPETLWELGYWLCYVNSTINPMCYAL
CNKAFRDTFRLLLLCRWDKRRWRKIPKRPGSVHRTPSRQC
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50345692
n/a
NameBDBM50345692
Synonyms:(3-endo)-3-(2,2-Di-2-thienylethenyl)-8,8-dimethyl-8-azoniabicyclo[3.2.1]octane Bromide | CHEMBL1785081
TypeSmall organic molecule
Emp. Form.C19H24NS2
Mol. Mass.330.53
SMILES[#6][N+]1([#6])[#6@@H]-2-[#6]-[#6]-[#6@@H]1-[#6]-[#6](-[#6]-2)\[#6]=[#6](/c1cccs1)-c1cccs1 |r,THB:10:8:1:4.5|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: