Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCalmodulin-domain protein kinase 1 (CDPK1)
LigandBDBM50229961
Substrate/Competitorn/a
Meas. Tech.ChEMBL_750529
IC50 1600±n/a nM
Citation Murphy RCOjo KKLarson ETCastellanos-Gonzalez APerera BGKeyloun KRKim JEBhandari JGMuller NRVerlinde CLWhite ACMerritt EAVan Voorhis WCMaly DJ Discovery of Potent and Selective Inhibitors of Calcium-Dependent Protein Kinase 1 (CDPK1) from C. parvum and T. gondii. ACS Med Chem Lett 1:331-335 (2011) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Calmodulin-domain protein kinase 1 (CDPK1)
Name:Calmodulin-domain protein kinase 1 (CDPK1)
Synonyms:Calmodulin-domain protein kinase 1 | Calmodulin-domain protein kinase, putative
Type:Enzyme Catalytic Domain
Mol. Mass.:57248.42
Organism:Toxoplasma gondii
Description:n/a
Residue:507
Sequence:
MGQQESTLGGAAGEPRSRGHAAGTSGGPGDHLHATPGMFVQHSTAIFSDRYKGQRVLGKG
SFGEVILCKDKITGQECAVKVISKRQVKQKTDKESLLREVQLLKQLDHPNIMKLYEFFED
KGYFYLVGEVYTGGELFDEIISRKRFSEVDAARIIRQVLSGITYMHKNKIVHRDLKPENL
LLESKSKDANIRIIDFGLSTHFEASKKMKDKIGTAYYIAPEVLHGTYDEKCDVWSTGVIL
YILLSGCPPFNGANEYDILKKVEKGKYTFELPQWKKVSESAKDLIRKMLTYVPSMRISAR
DALDHEWIQTYTKEQISVDVPSLDNAILNIRQFQGTQKLAQAALLYMGSKLTSQDETKEL
TAIFHKMDKNGDGQLDRAELIEGYKELMRMKGQDASMLDASAVEHEVDQVLDAVDFDKNG
YIEYSEFVTVAMDRKTLLSRERLERAFRMFDSDNSGKISSTELATIFGVSDVDSETWKSV
LSEVDKNNDGEVDFDEFQQMLLKLCGN
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50229961
n/a
NameBDBM50229961
Synonyms:1-(1,1-dimethylethyl)-3-(1-naphthalenyl)-1H-pyrazolo[3,4-d]pyrimidin-4-amine | 1-(tert-butyl)-3-(naphthalen-1-yl)-1H-pyrazolo[3,4-d]pyrimidin-4-amine (4) | 1-NA-PP1 | 1-tert-butyl-3-(naphthalen-1-yl)-1H-pyrazolo[3,4-d]pyrimidin-4-amine (4) | 1-tert-butyl-3-naphthalen-1-yl-1H-pyrazolo[3,4-d]pyrimidin-4-amine | 4-Amino-1-tert-butyl-3-(1'-naphthyl)pyrazolo[3,4-d]pyrimidine | CHEMBL264406 | US9765037, Compound 1
TypeSmall organic molecule
Emp. Form.C19H19N5
Mol. Mass.317.3877
SMILESCC(C)(C)n1nc(-c2cccc3ccccc23)c2c(N)ncnc12
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: