| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Translocator protein |
|---|
| Ligand | BDBM22032 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_763593 (CHEMBL1820034) |
|---|
| Ki | 7.11±n/a nM |
|---|
| Citation |  Damont, A; Boisgard, R; Kuhnast, B; Lemée, F; Raggiri, G; Scarf, AM; Da Pozzo, E; Selleri, S; Martini, C; Tavitian, B; Kassiou, M; Dollé, F Synthesis of 6-[¹8F]fluoro-PBR28, a novel radiotracer for imaging the TSPO 18 kDa with PET. Bioorg Med Chem Lett21:4819-22 (2011) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Translocator protein |
|---|
| Name: | Translocator protein |
|---|
| Synonyms: | BZRP | MBR | Mitochondrial benzodiazepine receptor | PBR | PKBS | Peripheral benzodiazepine receptor-related protein | Peripheral-type benzodiazepine receptor | TSPO | TSPO_HUMAN |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 18834.74 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P30536 |
|---|
| Residue: | 169 |
|---|
| Sequence: | MAPPWVPAMGFTLAPSLGCFVGSRFVHGEGLRWYAGLQKPSWHPPHWVLGPVWGTLYSAM
GYGSYLVWKELGGFTEKAVVPLGLYTGQLALNWAWPPIFFGARQMGWALVDLLLVSGAAA
ATTVAWYQVSPLAARLLYPYLAWLAFTTTLNYCVWRDNHGWRGGRRLPE
|
|
|
|---|
| BDBM22032 |
|---|
| n/a |
|---|
| Name | BDBM22032 |
|---|
| Synonyms: | 1-(2-chlorophenyl)-N-methyl-N-(1-methylpropyl)isoquinoline-3-carboxamide | CHEMBL15313 | N-(butan-2-yl)-1-(2-chlorophenyl)-N-methylisoquinoline-3-carboxamide | PK 11195 | PK-11195 | PK11195 | RP 52028 | [3H]PK 11195 |
|---|
| Type | radiolabeled ligand |
|---|
| Emp. Form. | C21H21ClN2O |
|---|
| Mol. Mass. | 352.857 |
|---|
| SMILES | CCC(C)N(C)C(=O)c1cc2ccccc2c(n1)-c1ccccc1Cl |
|---|
| Structure | 
|
|---|
Search and Browse
