| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Protein E6 |
|---|
| Ligand | BDBM26658 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_811818 (CHEMBL2014495) |
|---|
| IC50 | 4000±n/a nM |
|---|
| Citation |  Yuan, CH; Filippova, M; Tungteakkhun, SS; Duerksen-Hughes, PJ; Krstenansky, JL Small molecule inhibitors of the HPV16-E6 interaction with caspase 8. Bioorg Med Chem Lett22:2125-9 (2012) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Protein E6 |
|---|
| Name: | Protein E6 |
|---|
| Synonyms: | E6 | VE6_HPV16 |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 19201.73 |
|---|
| Organism: | Human papillomavirus type 16 |
|---|
| Description: | ChEMBL_811818 |
|---|
| Residue: | 158 |
|---|
| Sequence: | MHQKRTAMFQDPQERPRKLPQLCTELQTTIHDIILECVYCKQQLLRREVYDFAFRDLCIV
YRDGNPYAVCDKCLKFYSKISEYRHYCYSLYGTTLEQQYNKPLCDLLIRCINCQKPLCPE
EKQRHLDKKQRFHNIRGRWTGRCMSCCRSSRTRRETQL
|
|
|
|---|
| BDBM26658 |
|---|
| n/a |
|---|
| Name | BDBM26658 |
|---|
| Synonyms: | 2-(2,4-dihydroxyphenyl)-3,5,7-trihydroxy-1-benzopyran-4-one | 2-(2,4-dihydroxyphenyl)-3,5,7-trihydroxy-4H-chromen-4-one | 2-(2,4-dihydroxyphenyl)-3,5,7-trihydroxy-chromone | 2-(2,4-dihydroxyphenyl)-3,5,7-trihydroxychromen-4-one | 2-[2,4-bis(oxidanyl)phenyl]-3,5,7-tris(oxidanyl)chromen-4-one | CHEMBL28626 | MLS000069618 | Morin (19) | Morin (5) | Morin (Mor) | SMR000058259 | cid_5281670 | morin |
|---|
| Type | Flavonoid |
|---|
| Emp. Form. | C15H10O7 |
|---|
| Mol. Mass. | 302.2357 |
|---|
| SMILES | Oc1ccc(c(O)c1)-c1oc2cc(O)cc(O)c2c(=O)c1O |
|---|
| Structure | 
|
|---|
Search and Browse
