Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetSerine/threonine-protein kinase TBK1
LigandBDBM50379364
Substrate/Competitorn/a
Meas. Tech.ChEMBL_811983
EC50 1460±n/a nM
Citation Wang TBlock MACowen SDavies AMDevereaux EGingipalli LJohannes JLarsen NASu QTucker JAWhitston DWu JZhang HJZinda MChuaqui C Discovery of azabenzimidazole derivatives as potent, selective inhibitors of TBK1/IKKe kinases. Bioorg Med Chem Lett 22:2063-9 (2012) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Serine/threonine-protein kinase TBK1
Name:Serine/threonine-protein kinase TBK1
Synonyms:NAK | NF-kappa-B-activating kinase | T2K | TANK-binding kinase 1 (TBK-1) | TANK-binding kinase 1 (TBK1) | TBK1
Type:protein
Mol. Mass.:83645.20
Organism:Homo sapiens (Human)
Description:Q9UHD2
Residue:729
Sequence:
MQSTSNHLWLLSDILGQGATANVFRGRHKKTGDLFAIKVFNNISFLRPVDVQMREFEVLK
KLNHKNIVKLFAIEEETTTRHKVLIMEFCPCGSLYTVLEEPSNAYGLPESEFLIVLRDVV
GGMNHLRENGIVHRDIKPGNIMRVIGEDGQSVYKLTDFGAARELEDDEQFVSLYGTEEYL
HPDMYERAVLRKDHQKKYGATVDLWSIGVTFYHAATGSLPFRPFEGPRRNKEVMYKIITG
KPSGAISGVQKAENGPIDWSGDMPVSCSLSRGLQVLLTPVLANILEADQEKCWGFDQFFA
ETSDILHRMVIHVFSLQQMTAHKIYIHSYNTATIFHELVYKQTKIISSNQELIYEGRRLV
LEPGRLAQHFPKTTEENPIFVVSREPLNTIGLIYEKISLPKVHPRYDLDGDASMAKAITG
VVCYACRIASTLLLYQELMRKGIRWLIELIKDDYNETVHKKTEVVITLDFCIRNIEKTVK
VYEKLMKINLEAAELGEISDIHTKLLRLSSSQGTIETSLQDIDSRLSPGGSLADAWAHQE
GTHPKDRNVEKLQVLLNCMTEIYYQFKKDKAERRLAYNEEQIHKFDKQKLYYHATKAMTH
FTDECVKKYEAFLNKSEEWIRKMLHLRKQLLSLTNQCFDIEEEVSKYQEYTNELQETLPQ
KMFTASSGIKHTMTPIYPSSNTLVEMTLGMKKLKEEMEGVVKELAENNHILERFGSLTMD
GGLRNVDCL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50379364
n/a
NameBDBM50379364
Synonyms:CHEMBL2011942
TypeSmall organic molecule
Emp. Form.C28H37N7O3
Mol. Mass.519.6385
SMILESNC(=O)c1cnc2nc([nH]c2c1NCCCNC(=O)C1CCC1)-c1ccc(OCCN2CCCCC2)cc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: