Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetPeptide deformylase
LigandBDBM50379509
Substrate/Competitorn/a
Meas. Tech.ChEMBL_812366
IC50 35800±n/a nM
Citation Kwon YJSohn MJKim CJKoshino HKim WG Flavimycins A and B, dimeric 1,3-dihydroisobenzofurans with peptide deformylase inhibitory activity from Aspergillus flavipes. J Nat Prod 75:271-4 (2012) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Peptide deformylase
Name:Peptide deformylase
Synonyms:PDF | Polypeptide deformylase | def | def1
Type:Enzyme
Mol. Mass.:20556.80
Organism:Staphylococcus aureus
Description:P68825
Residue:183
Sequence:
MLTMKDIIRDGHPTLRQKAAELELPLTKEEKETLIAMREFLVNSQDEEIAKRYGLRSGVG
LAAPQINISKRMIAVLIPDDGSGKSYDYMLVNPKIVSHSVQEAYLPTGEGCLSVDDNVAG
LVHRHNRITIKAKDIEGNDIQLRLKGYPAIVFQHEIDHLNGVMFYDHIDKNHPLQPHTDA
VEV
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50379509
n/a
NameBDBM50379509
Synonyms:CHEMBL2012550
TypeSmall organic molecule
Emp. Form.C18H18O9
Mol. Mass.378.3301
SMILESCc1c2CO[C@@H]([C@H]3OC(O)c4c3c(O)c(O)c(O)c4C)c2c(O)c(O)c1O |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: