| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Peptide deformylase |
|---|
| Ligand | BDBM50379509 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_812366 (CHEMBL2014102) |
|---|
| IC50 | 35800±n/a nM |
|---|
| Citation |  Kwon, YJ; Sohn, MJ; Kim, CJ; Koshino, H; Kim, WG Flavimycins A and B, dimeric 1,3-dihydroisobenzofurans with peptide deformylase inhibitory activity from Aspergillus flavipes. J Nat Prod75:271-4 (2012) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Peptide deformylase |
|---|
| Name: | Peptide deformylase |
|---|
| Synonyms: | DEF_STAAM | PDF | Polypeptide deformylase | def | def1 | pdf1 |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 20556.80 |
|---|
| Organism: | Staphylococcus aureus |
|---|
| Description: | P68825 |
|---|
| Residue: | 183 |
|---|
| Sequence: | MLTMKDIIRDGHPTLRQKAAELELPLTKEEKETLIAMREFLVNSQDEEIAKRYGLRSGVG
LAAPQINISKRMIAVLIPDDGSGKSYDYMLVNPKIVSHSVQEAYLPTGEGCLSVDDNVAG
LVHRHNRITIKAKDIEGNDIQLRLKGYPAIVFQHEIDHLNGVMFYDHIDKNHPLQPHTDA
VEV
|
|
|
|---|
| BDBM50379509 |
|---|
| n/a |
|---|
| Name | BDBM50379509 |
|---|
| Synonyms: | CHEMBL2012550 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C18H18O9 |
|---|
| Mol. Mass. | 378.3301 |
|---|
| SMILES | Cc1c2CO[C@@H]([C@H]3OC(O)c4c3c(O)c(O)c(O)c4C)c2c(O)c(O)c1O |r| |
|---|
| Structure | 
|
|---|
Search and Browse
