Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetSerine/threonine-protein kinase haspin
LigandBDBM50379525
Substrate/Competitorn/a
Meas. Tech.ChEMBL_812377
IC50 190±n/a nM
Citation Cuny GDUlyanova NPPatnaik DLiu JFLin XAuerbach KRay SSXian JGlicksman MAStein RLHiggins JM Structure-activity relationship study of beta-carboline derivatives as haspin kinase inhibitors. Bioorg Med Chem Lett 22:2015-9 (2012) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Serine/threonine-protein kinase haspin
Name:Serine/threonine-protein kinase haspin
Synonyms:Germ cell-specific gene 2 protein | H-haspin | Haploid germ cell-specific nuclear protein kinase
Type:PROTEIN
Mol. Mass.:88531.28
Organism:Homo sapiens (Human)
Description:ChEMBL_1510616
Residue:798
Sequence:
MAASLPGPGSRLFRTYGAADGRRQRRPGREAAQWFPPQDRRRFFNSSGSSDASIGDPSQS
DDPDDPDDPDFPGSPVRRRRRRPGGRVPKDRPSLTVTPKRWKLRARPSLTVTPRRLGLRA
RPPQKCSTPCGPLRLPPFPSRDSGRLSPDLSVCGQPRDGDELGISASLFSSLASPCPGSP
TPRDSVISIGTSACLVAASAVPSGLHLPEVSLDRASLPCSQEEATGGAKDTRMVHQTRAS
LRSVLFGLMNSGTPEDSEFRADGKNMRESCCKRKLVVGNGPEGPGLSSTGKRRATGQDSC
QERGLQEAVRREHQEASVPKGRIVPRGIDRLERTRSSRKSKHQEATETSLLHSHRFKKGQ
KLGKDSFPTQDLTPLQNVCFWTKTRASFSFHKKKIVTDVSEVCSIYTTATSLSGSLLSEC
SNRPVMNRTSGAPSSWHSSSMYLLSPLNTLSISNKKASDAEKVYGECSQKGPVPFSHCLP
TEKLQRCEKIGEGVFGEVFQTIADHTPVAIKIIAIEGPDLVNGSHQKTFEEILPEIIISK
ELSLLSGEVCNRTEGFIGLNSVHCVQGSYPPLLLKAWDHYNSTKGSANDRPDFFKDDQLF
IVLEFEFGGIDLEQMRTKLSSLATAKSILHQLTASLAVAEASLRFEHRDLHWGNVLLKKT
SLKKLHYTLNGKSSTIPSCGLQVSIIDYTLSRLERDGIVVFCDVSMDEDLFTGDGDYQFD
IYRLMKKENNNRWGEYHPYSNVLWLHYLTDKMLKQMTFKTKCNTPAMKQIKRKIQEFHRT
MLNFSSATDLLCQHSLFK
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50379525
n/a
NameBDBM50379525
Synonyms:CHEMBL2012562
TypeSmall organic molecule
Emp. Form.C18H23N3O
Mol. Mass.297.3947
SMILESCCc1nccc2c3ccc(OC)cc3n(CCCCN)c12
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: