Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAntrax lethal toxin
LigandBDBM50379543
Substrate/Competitorn/a
Meas. Tech.ChEMBL_811334
Ki 0.04±n/a nM
Citation Jiao GSKim SMoayeri MCrown DThai ACregar-Hernandez LMcKasson LSankaran BLehrer AWong TJohns LMargosiak SALeppla SHJohnson AT Antidotes to anthrax lethal factor intoxication. Part 3: Evaluation of core structures and further modifications to the C2-side chain. Bioorg Med Chem Lett 22:2242-6 (2012) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Antrax lethal toxin
Name:Antrax lethal toxin
Synonyms:Anthrax lethal factor | lethal factor
Type:PROTEIN
Mol. Mass.:93758.56
Organism:Bacillus anthracis
Description:ChEMBL_1460338
Residue:809
Sequence:
MNIKKEFIKVISMSCLVTAITLSGPVFIPLVQGAGGHGDVGMHVKEKEKNKDENKRKDEE
RNKTQEEHLKEIMKHIVKIEVKGEEAVKKEAAEKLLEKVPSDVLEMYKAIGGKIYIVDGD
ITKHISLEALSEDKKKIKDIYGKDALLHEHYVYAKEGYEPVLVIQSSEDYVENTEKALNV
YYEIGKILSRDILSKINQPYQKFLDVLNTIKNASDSDGQDLLFTNQLKEHPTDFSVEFLE
QNSNEVQEVFAKAFAYYIEPQHRDVLQLYAPEAFNYMDKFNEQEINLSLEELKDQRMLAR
YEKWEKIKQHYQHWSDSLSEEGRGLLKKLQIPIEPKKDDIIHSLSQEEKELLKRIQIDSS
DFLSTEEKEFLKKLQIDIRDSLSEEEKELLNRIQVDSSNPLSEKEKEFLKKLKLDIQPYD
INQRLQDTGGLIDSPSINLDVRKQYKRDIQNIDALLHQSIGSTLYNKIYLYENMNINNLT
ATLGADLVDSTDNTKINRGIFNEFKKNFKYSISSNYMIVDINERPALDNERLKWRIQLSP
DTRAGYLENGKLILQRNIGLEIKDVQIIKQSEKEYIRIDAKVVPKSKIDTKIQEAQLNIN
QEWNKALGLPKYTKLITFNVHNRYASNIVESAYLILNEWKNNIQSDLIKKVTNYLVDGNG
RFVFTDITLPNIAEQYTHQDEIYEQVHSKGLYVPESRSILLHGPSKGVELRNDSEGFIHE
FGHAVDDYAGYLLDKNQSDLVTNSKKFIDIFKEEGSNLTSYGRTNEAEFFAEAFRLMHST
DHAERLKVQKNAPKTFQFINDQIKFIINS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50379543
n/a
NameBDBM50379543
Synonyms:CHEMBL2012752
TypeSmall organic molecule
Emp. Form.C24H32F2N2O2
Mol. Mass.418.5199
SMILESCC[C@@H](NCCCC[C@@H](Cc1cc(C)c(F)c(C)c1)C(=O)NO)c1ccc(F)cc1 |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: