| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Cannabinoid receptor 2 |
|---|
| Ligand | BDBM50379702 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_812047 (CHEMBL2013473) |
|---|
| Ki | 263.03±n/a nM |
|---|
| Citation |  Nelson, DW; Frost, JM; Tietje, KR; Florjancic, AS; Ryther, K; Carroll, WA; Dart, MJ; Daza, AV; Hooker, BA; Grayson, GK; Fan, Y; Garrison, TR; El-Kouhen, OF; Yao, B; Pai, M; Chandran, P; Zhu, C; Hsieh, GC; Meyer, MD Synthesis and evaluation of 2-amido-3-carboxamide thiophene CB2 receptor agonists for pain management. Bioorg Med Chem Lett22:2604-8 (2012) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Cannabinoid receptor 2 |
|---|
| Name: | Cannabinoid receptor 2 |
|---|
| Synonyms: | CANNABINOID CB2 | CB-2 | CB2 | CNR2_RAT | Cannabinoid CB2 receptor | Cannabinoid receptor | Cnr2 | rCB2 |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 39366.68 |
|---|
| Organism: | Rattus norvegicus (Rat) |
|---|
| Description: | Q9QZN9 |
|---|
| Residue: | 360 |
|---|
| Sequence: | MAGCRELELTNGSNGGLEFNPMKEYMILSDAQQIAVAVLCTLMGLLSALENVAVLYLILS
SQRLRRKPSYLFIGSLAGADFLASVIFACNFVIFHVFHGVDSRNIFLLKIGSVTMTFTAS
VGSLLLTAVDRYLCLCYPPTYKALVTRGRALVALGVMWVLSALISYLPLMGWTCCPSPCS
ELFPLIPNDYLLGWLLFIAILFSGIIYTYGYVLWKAHQHVASLAEHQDRQVPGIARMRLD
VRLAKTLGLVMAVLLICWFPALALMGHSLVTTLSDKVKEAFAFCSMLCLVNSMINPIIYA
LRSGEIRSAAQHCLTGWKKYLQGLGSEGKEEAPKSSVTETEAEVKTTTGPGSRTPGCSNC
|
|
|
|---|
| BDBM50379702 |
|---|
| n/a |
|---|
| Name | BDBM50379702 |
|---|
| Synonyms: | CHEMBL2010899 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C21H28N2O4S |
|---|
| Mol. Mass. | 404.523 |
|---|
| SMILES | COCCNC(=O)c1c(NC(=O)C23CC4CC2CC(C3)C4)sc2COCCc12 |TLB:13:12:20.14.15:17,THB:10:12:20.14.15:17,13:14:17:19.12| |
|---|
| Structure | 
|
|---|
Search and Browse
