Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCarbonic anhydrase 13 (CA XIII)
LigandBDBM50380156
Substrate/Competitorn/a
Meas. Tech.ChEMBL_811727
Kd 13±n/a nM
Citation Capkauskaite EZubriene ABaranauskiene LTamulaitiene GManakova EKairys VGražulis STumkevicius SMatulis D Design of [(2-pyrimidinylthio)acetyl]benzenesulfonamides as inhibitors of human carbonic anhydrases. Eur J Med Chem 51:259-70 (2012) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Carbonic anhydrase 13 (CA XIII)
Name:Carbonic anhydrase 13 (CA XIII)
Synonyms:Carbonic anhydrase XIII (CA XIII)
Type:Enzyme
Mol. Mass.:29445.78
Organism:Homo sapiens (Human)
Description:Q8N1Q1
Residue:262
Sequence:
MSRLSWGYREHNGPIHWKEFFPIADGDQQSPIEIKTKEVKYDSSLRPLSIKYDPSSAKII
SNSGHSFNVDFDDTENKSVLRGGPLTGSYRLRQVHLHWGSADDHGSEHIVDGVSYAAELH
VVHWNSDKYPSFVEAAHEPDGLAVLGVFLQIGEPNSQLQKITDTLDSIKEKGKQTRFTNF
DLLSLLPPSWDYWTYPGSLTVPPLLESVTWIVLKQPINISSQQLAKFRSLLCTAEGEAAA
FLVSNHRPPQPLKGRKVRASFH
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50380156
n/a
NameBDBM50380156
Synonyms:CHEMBL2010990
TypeSmall organic molecule
Emp. Form.C20H19N3O4S2
Mol. Mass.429.513
SMILESCc1nc(SCC(=O)c2ccc(cc2)S(N)(=O)=O)[nH]c(=O)c1Cc1ccccc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: