BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCAMK2A
LigandBDBM50380246
Substrate/Competitorn/a
Meas. Tech.ChEMBL_813555
IC50>40000±n/a nM
Citation Maryanoff BEMcComsey DFYabut SCLuci DKJordan ADMasucci JAJones WJAbad MCGibbs ACPetrounia I Inhibitors of Ketohexokinase: Discovery of Pyrimidinopyrimidines with Specific Substitution that Complements the ATP-Binding Site. ACS Med Chem Lett 2:538-543 (2011) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
CAMK2A
Name:CAMK2A
Synonyms:CaM kinase II | CaM kinase II alpha | Calcium/calmodulin-dependent protein kinase type II subunit alpha (CAMK2a)
Type:Enzyme Catalytic Domain
Mol. Mass.:54093.63
Organism:Homo sapiens (Human)
Description:gi_25952118
Residue:478
Sequence:
MATITCTRFTEEYQLFEELGKGAFSVVRRCVKVLAGQEYAAKIINTKKLSARDHQKLERE
ARICRLLKHPNIVRLHDSISEEGHHYLIFDLVTGGELFEDIVAREYYSEADASHCIQQIL
EAVLHCHQMGVVHRDLKPENLLLASKLKGAAVKLADFGLAIEVEGEQQAWFGFAGTPGYL
SPEVLRKDPYGKPVDLWACGVILYILLVGYPPFWDEDQHRLYQQIKAGAYDFPSPEWDTV
TPEAKDLINKMLTINPSKRITAAEALKHPWISHRSTVASCMHRQETVDCLKKFNARRKLK
GAILTTMLATRNFSGGKSGGNKKSDGVKESSESTNTTIEDEDTKVRKQEIIKVTEQLIEA
ISNGDFESYTKMCDPGMTAFEPEALGNLVEGLDFHRFYFENLWSRNSKPVHTTILNPHIH
LMGDESACIAYIRITQYLDAGGIPRTAQSEETRVWHRRDGKWQIVHFHRSGAPSVLPH
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50380246
n/a
NameBDBM50380246
Synonyms:CHEMBL2017214
TypeSmall organic molecule
Emp. Form.C21H26N8S
Mol. Mass.422.55
SMILESCSc1ccccc1Nc1nc(nc2c(NCC3CC3)ncnc12)N1CCNCC1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: