Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetOxytocin receptor
LigandBDBM50380758
Substrate/Competitorn/a
Meas. Tech.ChEMBL_813468
Ki 3.6±n/a nM
Citation Smith ALFreeman SMStehouwer JSInoue KVoll RJYoung LJGoodman MM Synthesis and evaluation of C-11, F-18 and I-125 small molecule radioligands for detecting oxytocin receptors. Bioorg Med Chem 20:2721-38 (2012) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Oxytocin receptor
Name:Oxytocin receptor
Synonyms:OTR
Type:PROTEIN
Mol. Mass.:28131.82
Organism:Microtus ochrogaster
Description:ChEMBL_813468
Residue:259
Sequence:
MEGTPAANWSFELDLGSGVSPGVEGNLTAGPPQRNEALARVEVAVLCLILFLALSATVRA
AGLRTTTRHKHSRLFFFMKHLSIADLVVAVFQVLPQLLWDITFRFYGPDLLCRLVKYLQV
VGMFASTYLLLLMSLDRCLAICQPLRSLRRRTDRLAVLATWLGCLVASAPQVHIFSLREV
ADGVFDCWAVFIQPWGPNAYVTWITLAVYIVPVIVLAACYGLISFKIWQNLRLKTAAAAA
AAEGTEGSAAGGAARGAGS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50380758
n/a
NameBDBM50380758
Synonyms:CHEMBL2017867
TypeSmall organic molecule
Emp. Form.C31H38IN3O6S
Mol. Mass.707.619
SMILESCS(=O)(=O)N1CCC(CC1)Oc1ccc(CC(=O)N2CCC(CC2)N2C(=O)CCc3ccccc23)c(OC\C=C\I)c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: