Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetOxytocin receptor
LigandBDBM50380758
Substrate/Competitorn/a
Meas. Tech.ChEMBL_813470
Ki 10±n/a nM
Citation Smith ALFreeman SMStehouwer JSInoue KVoll RJYoung LJGoodman MM Synthesis and evaluation of C-11, F-18 and I-125 small molecule radioligands for detecting oxytocin receptors. Bioorg Med Chem 20:2721-38 (2012) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Oxytocin receptor
Name:Oxytocin receptor
Synonyms:OT-R | Oxytocin
Type:Enzyme Catalytic Domain
Mol. Mass.:42793.26
Organism:HEK293
Description:Oxytocin OXTR HEK293::B2R9L7
Residue:389
Sequence:
MEGALAANWSAEAANASAAPPGAEGNRTAGPPRRNEALARVEVAVLCLILLLALSGNACV
LLALRTTRQKHSRLFFFMKHLSIADLVVAVFQVLPQLLWDITFRFYGPDLLCRLVKYLQV
VGMFASTYLLLLMSLDRCLAICQPLRSLRRRTDRLAVLATWLGCLVASAPQVHIFSLREV
ADGVFDCWAVFIQPWGPKAYITWITLAVYIVPVIVLAACYGLISFKIWQNLRLKTAAAAA
AEAPEGAAAGDGGRVALARVSSVKLISKAKIRTVKMTFIIVLAFIVCWTPFFFVQMWSVW
DANAPKEASAFIIVMLLASLNSCCNPWIYMLFTGHLFHELVQRFLCCSASYLKGRRLGET
SASKKSNSSSFVLSHRSSSQRSCSQPSTA
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50380758
n/a
NameBDBM50380758
Synonyms:CHEMBL2017867
TypeSmall organic molecule
Emp. Form.C31H38IN3O6S
Mol. Mass.707.619
SMILESCS(=O)(=O)N1CCC(CC1)Oc1ccc(CC(=O)N2CCC(CC2)N2C(=O)CCc3ccccc23)c(OC\C=C\I)c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: