Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetC-C chemokine receptor type 4 (CCR4)
LigandBDBM50380884
Substrate/Competitorn/a
Meas. Tech.ChEMBL_812672
Kd 251.19±n/a nM
Citation Procopiou PAFord AJGraves RHHall DAHodgson STLacroix YMNeedham DSlack RJ Lead optimisation of the N1 substituent of a novel series of indazole arylsulfonamides as CCR4 antagonists and identification of a candidate for clinical investigation. Bioorg Med Chem Lett 22:2730-3 (2012) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
C-C chemokine receptor type 4 (CCR4)
Name:C-C chemokine receptor type 4
Synonyms:C-C CKR-4 | C-C chemokine receptor type 4 | CC-CKR-4 | CCR-4 | CCR4 | CD_antigen=CD194 | K5-5
Type:Enzyme
Mol. Mass.:41406.41
Organism:Homo sapiens (Human)
Description:P51679
Residue:360
Sequence:
MNPTDIADTTLDESIYSNYYLYESIPKPCTKEGIKAFGELFLPPLYSLVFVFGLLGNSVV
VLVLFKYKRLRSMTDVYLLNLAISDLLFVFSLPFWGYYAADQWVFGLGLCKMISWMYLVG
FYSGIFFVMLMSIDRYLAIVHAVFSLRARTLTYGVITSLATWSVAVFASLPGFLFSTCYT
ERNHTYCKTKYSLNSTTWKVLSSLEINILGLVIPLGIMLFCYSMIIRTLQHCKNEKKNKA
VKMIFAVVVLFLGFWTPYNIVLFLETLVELEVLQDCTFERYLDYAIQATETLAFVHCCLN
PIIYFFLGEKFRKYILQLFKTCRGLFVLCQYCGLLQIYSADTPSSSYTQSTMDHDLHDAL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50380884
n/a
NameBDBM50380884
Synonyms:CHEMBL2018954
TypeSmall organic molecule
Emp. Form.C23H27BrN4O5S
Mol. Mass.551.453
SMILESCOc1ccc(COc2nc(Br)cnc2NS(=O)(=O)c2ccc(C)cc2)cc1OCCN(C)C
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: