| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1 |
|---|
| Ligand | BDBM50381002 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_814117 (CHEMBL2020711) |
|---|
| IC50 | 6310±n/a nM |
|---|
| Citation |  Liu, C; Jin, J; Chen, L; Zhou, J; Chen, X; Fu, D; Song, H; Xu, B Synthesis and biological evaluation of novel human Pin1 inhibitors with benzophenone skeleton. Bioorg Med Chem20:2992-9 (2012) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1 |
|---|
| Name: | Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1 |
|---|
| Synonyms: | PIN1 | PIN1_HUMAN | PPIase Pin1 | Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1 |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 18248.11 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | ChEMBL_1502595 |
|---|
| Residue: | 163 |
|---|
| Sequence: | MADEEKLPPGWEKRMSRSSGRVYYFNHITNASQWERPSGNSSSGGKNGQGEPARVRCSHL
LVKHSQSRRPSSWRQEKITRTKEEALELINGYIQKIKSGEEDFESLASQFSDCSSAKARG
DLGAFSRGQMQKPFEDASFALRTGEMSGPVFTDSGIHIILRTE
|
|
|
|---|
| BDBM50381002 |
|---|
| n/a |
|---|
| Name | BDBM50381002 |
|---|
| Synonyms: | CHEMBL2017122 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C24H17N3O5 |
|---|
| Mol. Mass. | 427.4089 |
|---|
| SMILES | OC(=O)C(=O)Nc1ccc(NC(=O)c2cc3ccccc3[nH]2)cc1C(=O)c1ccccc1 |
|---|
| Structure | 
|
|---|
Search and Browse
