Reaction Details |
| Report a problem with these data |
Target | Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1 |
---|
Ligand | BDBM50381002 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_814117 (CHEMBL2020711) |
---|
IC50 | 6310±n/a nM |
---|
Citation | Liu, C; Jin, J; Chen, L; Zhou, J; Chen, X; Fu, D; Song, H; Xu, B Synthesis and biological evaluation of novel human Pin1 inhibitors with benzophenone skeleton. Bioorg Med Chem20:2992-9 (2012) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1 |
---|
Name: | Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1 |
Synonyms: | PIN1 | PIN1_HUMAN | PPIase Pin1 | Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1 |
Type: | PROTEIN |
Mol. Mass.: | 18248.11 |
Organism: | Homo sapiens (Human) |
Description: | ChEMBL_1502595 |
Residue: | 163 |
Sequence: | MADEEKLPPGWEKRMSRSSGRVYYFNHITNASQWERPSGNSSSGGKNGQGEPARVRCSHL
LVKHSQSRRPSSWRQEKITRTKEEALELINGYIQKIKSGEEDFESLASQFSDCSSAKARG
DLGAFSRGQMQKPFEDASFALRTGEMSGPVFTDSGIHIILRTE
|
|
|
BDBM50381002 |
---|
n/a |
---|
Name | BDBM50381002 |
Synonyms: | CHEMBL2017122 |
Type | Small organic molecule |
Emp. Form. | C24H17N3O5 |
Mol. Mass. | 427.4089 |
SMILES | OC(=O)C(=O)Nc1ccc(NC(=O)c2cc3ccccc3[nH]2)cc1C(=O)c1ccccc1 |
Structure |
|