Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetTyrosine-protein kinase TXK
LigandBDBM50381094
Substrate/Competitorn/a
Meas. Tech.ChEMBL_814176
IC50 66.5±n/a nM
Citation McLean LRZhang YZaidi NBi XWang RDharanipragada RJurcak JGGillespy TAZhao ZMusick KYChoi YMBarrague MPeppard JSmicker MDuguid MParkar AFordham JKominos D X-ray crystallographic structure-based design of selective thienopyrazole inhibitors for interleukin-2-inducible tyrosine kinase. Bioorg Med Chem Lett 22:3296-300 (2012) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Tyrosine-protein kinase TXK
Name:Tyrosine-protein kinase TXK
Synonyms:PTK4 | Protein-tyrosine kinase 4 | RLK | Resting lymphocyte kinase | TXK | Tyrosine-protein kinase TXK (TXK)
Type:Protein
Mol. Mass.:61268.80
Organism:Homo sapiens (Human)
Description:P42681
Residue:527
Sequence:
MILSSYNTIQSVFCCCCCCSVQKRQMRTQISLSTDEELPEKYTQRRRPWLSQLSNKKQSN
TGRVQPSKRKPLPPLPPSEVAEEKIQVKALYDFLPREPCNLALRRAEEYLILEKYNPHWW
KARDRLGNEGLIPSNYVTENKITNLEIYEWYHRNITRNQAEHLLRQESKEGAFIVRDSRH
LGSYTISVFMGARRSTEAAIKHYQIKKNDSGQWYVAERHAFQSIPELIWYHQHNAAGLMT
RLRYPVGLMGSCLPATAGFSYEKWEIDPSELAFIKEIGSGQFGVVHLGEWRSHIQVAIKA
INEGSMSEEDFIEEAKVMMKLSHSKLVQLYGVCIQRKPLYIVTEFMENGCLLNYLRENKG
KLRKEMLLSVCQDICEGMEYLERNGYIHRDLAARNCLVSSTCIVKISDFGMTRYVLDDEY
VSSFGAKFPIKWSPPEVFLFNKYSSKSDVWSFGVLMWEVFTEGKMPFENKSNLQVVEAIS
EGFRLYRPHLAPMSIYEVMYSCWHEKPEGRPTFAELLRAVTEIAETW
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50381094
n/a
NameBDBM50381094
Synonyms:CHEMBL2017553
TypeSmall organic molecule
Emp. Form.C18H19N3OS
Mol. Mass.325.428
SMILESCCC(O)(CC)c1ccc2cc([nH]c2c1)-c1n[nH]c2ccsc12
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: