Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetSerine/threonine-protein kinase pknB
LigandBDBM50381105
Substrate/Competitorn/a
Meas. Tech.ChEMBL_814187
IC50 202±n/a nM
Citation Chapman TMBouloc NBuxton RSChugh JLougheed KEOsborne SASaxty BSmerdon SJTaylor DLWhalley D Substituted aminopyrimidine protein kinase B (PknB) inhibitors show activity against Mycobacterium tuberculosis. Bioorg Med Chem Lett 22:3349-53 (2012) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Serine/threonine-protein kinase pknB
Name:Serine/threonine-protein kinase pknB
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:66497.93
Organism:Mycobacterium tuberculosis
Description:ChEMBL_774233
Residue:626
Sequence:
MTTPSHLSDRYELGEILGFGGMSEVHLARDLRLHRDVAVKVLRADLARDPSFYLRFRREA
QNAAALNHPAIVAVYDTGEAETPAGPLPYIVMEYVDGVTLRDIVHTEGPMTPKRAIEVIA
DACQALNFSHQNGIIHRDVKPANIMISATNAVKVMDFGIARAIADSGNSVTQTAAVIGTA
QYLSPEQARGDSVDARSDVYSLGCVLYEVLTGEPPFTGDSPVSVAYQHVREDPIPPSARH
EGLSADLDAVVLKALAKNPENRYQTAAEMRADLVRVHNGEPPEAPKVLTDAERTSLLSSA
AGNLSGPRTDPLPRQDLDDTDRDRSIGSVGRWVAVVAVLAVLTVVVTIAINTFGGITRDV
QVPDVRGQSSADAIATLQNRGFKIRTLQKPDSTIPPDHVIGTDPAANTSVSAGDEITVNV
STGPEQREIPDVSTLTYAEAVKKLTAAGFGRFKQANSPSTPELVGKVIGTNPPANQTSAI
TNVVIIIVGSGPATKDIPDVAGQTVDVAQKNLNVYGFTKFSQASVDSPRPAGEVTGTNPP
AGTTVPVDSVIELQVSKGNQFVMPDLSGMFWVDAEPRLRALGWTGMLDKGADVDAGGSQH
NRVVYQNPPAGTGVNRDGIITLRFGQ
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50381105
n/a
NameBDBM50381105
Synonyms:CHEMBL2017720
TypeSmall organic molecule
Emp. Form.C15H14N6
Mol. Mass.278.3119
SMILESC1CC1c1cc(Nc2ccnc(n2)-c2cccnc2)[nH]n1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: