Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCarbonic Anhydrase III
LigandBDBM50381319
Substrate/Competitorn/a
Meas. Tech.ChEMBL_814448
Ki 4580±n/a nM
Citation Balboni GCongiu COnnis VMaresca AScozzafava AWinum JYMaietti ASupuran CT Flavones and structurally related 4-chromenones inhibit carbonic anhydrases by a different mechanism of action compared to coumarins. Bioorg Med Chem Lett 22:3063-6 (2012) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Carbonic Anhydrase III
Name:Carbonic Anhydrase III
Synonyms:CA-III | Carbonate dehydratase III | Carbonic anhydrase 3 (CA III) | Carbonic anhydrase III (CA III)
Type:Enzyme
Mol. Mass.:29562.11
Organism:Homo sapiens (Human)
Description:Human cloned isozyme.
Residue:260
Sequence:
MAKEWGYASHNGPDHWHELFPNAKGENQSPVELHTKDIRHDPSLQPWSVSYDGGSAKTIL
NNGKTCRVVFDDTYDRSMLRGGPLPGPYRLRQFHLHWGSSDDHGSEHTVDGVKYAAELHL
VHWNPKYNTFKEALKQRDGIAVIGIFLKIGHENGEFQIFLDALDKIKTKGKEAPFTKFDP
SCLFPACRDYWTYQGSFTTPPCEECIVWLLLKEPMTVSSDQMAKLRSLLSSAENEPPVPL
VSNWRPPQPINNRVVRASFK
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50381319
n/a
NameBDBM50381319
Synonyms:CHEMBL2019143
TypeSmall organic molecule
Emp. Form.C16H12ClNO3
Mol. Mass.301.724
SMILESCOc1ccc(cc1)-c1c(N)oc2ccc(Cl)cc2c1=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: