Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetMuscarinic acetylcholine receptor M3
LigandBDBM50381641
Substrate/Competitorn/a
Meas. Tech.ChEMBL_815844
Kd 0.631±n/a nM
Citation Lainé DIYan HXie HDavis RSDufour JWiddowson KLPalovich MRWan ZFoley JJSchmidt DBHunsberger GEBurman MBacon AMWebb EFLuttmann MASalmon MSarau HMUmbrecht STLandis PSPeck BJBusch-Petersen J Design, synthesis and structure-activity relationship of N-substituted tropane muscarinic acetylcholine receptor antagonists. Bioorg Med Chem Lett 22:3366-9 (2012) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Muscarinic acetylcholine receptor M3
Name:Muscarinic acetylcholine receptor M1 and M3
Synonyms:CHRM3 | Cholinergic, muscarinic M3 | Muscarinic Receptors M3 | Muscarinic receptor M3 | RecName: Full=Muscarinic acetylcholine receptor M3
Type:Enzyme
Mol. Mass.:66151.03
Organism:Homo sapiens (Human)
Description:P20309
Residue:590
Sequence:
MTLHNNSTTSPLFPNISSSWIHSPSDAGLPPGTVTHFGSYNVSRAAGNFSSPDGTTDDPL
GGHTVWQVVFIAFLTGILALVTIIGNILVIVSFKVNKQLKTVNNYFLLSLACADLIIGVI
SMNLFTTYIIMNRWALGNLACDLWLAIDYVASNASVMNLLVISFDRYFSITRPLTYRAKR
TTKRAGVMIGLAWVISFVLWAPAILFWQYFVGKRTVPPGECFIQFLSEPTITFGTAIAAF
YMPVTIMTILYWRIYKETEKRTKELAGLQASGTEAETENFVHPTGSSRSCSSYELQQQSM
KRSNRRKYGRCHFWFTTKSWKPSSEQMDQDHSSSDSWNNNDAAASLENSASSDEEDIGSE
TRAIYSIVLKLPGHSTILNSTKLPSSDNLQVPEEELGMVDLERKADKLQAQKSVDDGGSF
PKSFSKLPIQLESAVDTAKTSDVNSSVGKSTATLPLSFKEATLAKRFALKTRSQITKRKR
MSLVKEKKAAQTLSAILLAFIITWTPYNIMVLVNTFCDSCIPKTFWNLGYWLCYINSTVN
PVCYALCNKTFRTTFKMLLLCQCDKKKRRKQQYQQRQSVIFHKRAPEQAL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50381641
n/a
NameBDBM50381641
Synonyms:CHEMBL2023758
TypeSmall organic molecule
Emp. Form.C28H37N2O2
Mol. Mass.433.605
SMILESCOCCOCC[N+]1(C)C2CCC1C[C@@H](CC(C#N)(c1ccccc1)c1ccccc1)C2 |r,wD:14.15,TLB:8:7:14.13.31:11.10,THB:6:7:14.13.31:11.10,15:14:7:11.10,(-7.22,-32.85,;-7.99,-34.19,;-7.21,-35.52,;-7.97,-36.86,;-7.19,-38.19,;-7.95,-39.53,;-7.17,-40.86,;-7.93,-42.2,;-9.43,-41.79,;-6.88,-43.03,;-7.48,-44.37,;-8.66,-45.08,;-7.67,-43.73,;-5.83,-43.73,;-4.85,-44.54,;-4.08,-45.87,;-2.54,-45.87,;-2.15,-44.37,;-1.75,-42.87,;-1.77,-47.2,;-2.53,-48.53,;-1.76,-49.86,;-.22,-49.86,;.55,-48.51,;-.23,-47.19,;-1.06,-45.46,;.03,-46.54,;1.51,-46.14,;1.9,-44.65,;.8,-43.57,;-.68,-43.98,;-5.12,-43,)|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: