Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetMuscarinic acetylcholine receptor M3
LigandBDBM50381650
Substrate/Competitorn/a
Meas. Tech.ChEMBL_815844
Kd 0.501±n/a nM
Citation Lainé DIYan HXie HDavis RSDufour JWiddowson KLPalovich MRWan ZFoley JJSchmidt DBHunsberger GEBurman MBacon AMWebb EFLuttmann MASalmon MSarau HMUmbrecht STLandis PSPeck BJBusch-Petersen J Design, synthesis and structure-activity relationship of N-substituted tropane muscarinic acetylcholine receptor antagonists. Bioorg Med Chem Lett 22:3366-9 (2012) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Muscarinic acetylcholine receptor M3
Name:Muscarinic acetylcholine receptor M1 and M3
Synonyms:CHRM3 | Cholinergic, muscarinic M3 | Muscarinic Receptors M3 | Muscarinic receptor M3 | RecName: Full=Muscarinic acetylcholine receptor M3
Type:Enzyme
Mol. Mass.:66151.03
Organism:Homo sapiens (Human)
Description:P20309
Residue:590
Sequence:
MTLHNNSTTSPLFPNISSSWIHSPSDAGLPPGTVTHFGSYNVSRAAGNFSSPDGTTDDPL
GGHTVWQVVFIAFLTGILALVTIIGNILVIVSFKVNKQLKTVNNYFLLSLACADLIIGVI
SMNLFTTYIIMNRWALGNLACDLWLAIDYVASNASVMNLLVISFDRYFSITRPLTYRAKR
TTKRAGVMIGLAWVISFVLWAPAILFWQYFVGKRTVPPGECFIQFLSEPTITFGTAIAAF
YMPVTIMTILYWRIYKETEKRTKELAGLQASGTEAETENFVHPTGSSRSCSSYELQQQSM
KRSNRRKYGRCHFWFTTKSWKPSSEQMDQDHSSSDSWNNNDAAASLENSASSDEEDIGSE
TRAIYSIVLKLPGHSTILNSTKLPSSDNLQVPEEELGMVDLERKADKLQAQKSVDDGGSF
PKSFSKLPIQLESAVDTAKTSDVNSSVGKSTATLPLSFKEATLAKRFALKTRSQITKRKR
MSLVKEKKAAQTLSAILLAFIITWTPYNIMVLVNTFCDSCIPKTFWNLGYWLCYINSTVN
PVCYALCNKTFRTTFKMLLLCQCDKKKRRKQQYQQRQSVIFHKRAPEQAL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50381650
n/a
NameBDBM50381650
Synonyms:CHEMBL2023752
TypeSmall organic molecule
Emp. Form.C26H33N2O
Mol. Mass.389.5525
SMILESCOCC[N+]1(C)C2CCC1C[C@@H](CC(C#N)(c1ccccc1)c1ccccc1)C2 |r,wD:11.12,TLB:5:4:11.10.28:8.7,THB:3:4:11.10.28:8.7,12:11:4:8.7,(18.45,-5.24,;19.23,-6.57,;18.46,-7.91,;19.24,-9.24,;18.48,-10.58,;16.99,-10.17,;19.54,-11.41,;18.94,-12.75,;17.76,-13.46,;18.74,-12.12,;20.58,-12.12,;21.56,-12.93,;22.34,-14.26,;23.88,-14.25,;24.27,-12.76,;24.66,-11.26,;24.65,-15.59,;23.88,-16.92,;24.65,-18.25,;26.19,-18.24,;26.96,-16.9,;26.18,-15.57,;25.36,-13.85,;26.45,-14.93,;27.93,-14.52,;28.32,-13.03,;27.21,-11.95,;25.74,-12.37,;21.3,-11.38,)|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: