Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetMuscarinic acetylcholine receptor M3
LigandBDBM50381655
Substrate/Competitorn/a
Meas. Tech.ChEMBL_815844
Kd 0.0794±n/a nM
Citation Lainé DIYan HXie HDavis RSDufour JWiddowson KLPalovich MRWan ZFoley JJSchmidt DBHunsberger GEBurman MBacon AMWebb EFLuttmann MASalmon MSarau HMUmbrecht STLandis PSPeck BJBusch-Petersen J Design, synthesis and structure-activity relationship of N-substituted tropane muscarinic acetylcholine receptor antagonists. Bioorg Med Chem Lett 22:3366-9 (2012) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Muscarinic acetylcholine receptor M3
Name:Muscarinic acetylcholine receptor M1 and M3
Synonyms:CHRM3 | Cholinergic, muscarinic M3 | Muscarinic Receptors M3 | Muscarinic receptor M3 | RecName: Full=Muscarinic acetylcholine receptor M3
Type:Enzyme
Mol. Mass.:66151.03
Organism:Homo sapiens (Human)
Description:P20309
Residue:590
Sequence:
MTLHNNSTTSPLFPNISSSWIHSPSDAGLPPGTVTHFGSYNVSRAAGNFSSPDGTTDDPL
GGHTVWQVVFIAFLTGILALVTIIGNILVIVSFKVNKQLKTVNNYFLLSLACADLIIGVI
SMNLFTTYIIMNRWALGNLACDLWLAIDYVASNASVMNLLVISFDRYFSITRPLTYRAKR
TTKRAGVMIGLAWVISFVLWAPAILFWQYFVGKRTVPPGECFIQFLSEPTITFGTAIAAF
YMPVTIMTILYWRIYKETEKRTKELAGLQASGTEAETENFVHPTGSSRSCSSYELQQQSM
KRSNRRKYGRCHFWFTTKSWKPSSEQMDQDHSSSDSWNNNDAAASLENSASSDEEDIGSE
TRAIYSIVLKLPGHSTILNSTKLPSSDNLQVPEEELGMVDLERKADKLQAQKSVDDGGSF
PKSFSKLPIQLESAVDTAKTSDVNSSVGKSTATLPLSFKEATLAKRFALKTRSQITKRKR
MSLVKEKKAAQTLSAILLAFIITWTPYNIMVLVNTFCDSCIPKTFWNLGYWLCYINSTVN
PVCYALCNKTFRTTFKMLLLCQCDKKKRRKQQYQQRQSVIFHKRAPEQAL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50381655
n/a
NameBDBM50381655
Synonyms:CHEMBL2021998
TypeSmall organic molecule
Emp. Form.C31H43N2
Mol. Mass.443.686
SMILESCCCCCCCC[N@@+]1(C)C2CCC1C[C@@H](CC(C#N)(c1ccccc1)c1ccccc1)C2 |r,wU:8.7,wD:15.16,8.8,TLB:9:8:15.14.32:12.11,THB:7:8:15.14.32:12.11,16:15:8:12.11,(22.9,-27.86,;23.68,-29.18,;22.92,-30.52,;23.69,-31.85,;22.93,-33.19,;23.71,-34.52,;22.95,-35.86,;23.73,-37.19,;22.97,-38.52,;21.47,-38.12,;24.02,-39.36,;23.42,-40.7,;22.24,-41.41,;23.23,-40.06,;25.07,-40.06,;26.05,-40.87,;26.82,-42.2,;28.36,-42.2,;28.75,-40.7,;29.15,-39.2,;29.14,-43.53,;28.37,-44.86,;29.14,-46.19,;30.68,-46.19,;31.45,-44.84,;30.67,-43.52,;29.84,-41.79,;30.94,-42.87,;32.42,-42.47,;32.8,-40.98,;31.7,-39.9,;30.22,-40.31,;25.78,-39.32,)|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: