| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Fatty acid-binding protein, adipocyte |
|---|
| Ligand | BDBM50381857 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_817178 (CHEMBL2025789) |
|---|
| Ki | 33±n/a nM |
|---|
| Citation |  Xu, Q; Huang, L; Liu, J; Ma, L; Chen, T; Chen, J; Peng, F; Cao, D; Yang, Z; Qiu, N; Qiu, J; Wang, G; Liang, X; Peng, A; Xiang, M; Wei, Y; Chen, L Design, synthesis and biological evaluation of thiazole- and indole-based derivatives for the treatment of type II diabetes. Eur J Med Chem52:70-81 (2012) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Fatty acid-binding protein, adipocyte |
|---|
| Name: | Fatty acid-binding protein, adipocyte |
|---|
| Synonyms: | A-FABP | AFABP | ALBP | Adipocyte lipid-binding protein | Adipocyte-type fatty acid-binding protein | FABP4_RAT | Fabp4 | Fatty acid-binding protein 4 |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 14709.32 |
|---|
| Organism: | Rattus norvegicus |
|---|
| Description: | ChEMBL_817178 |
|---|
| Residue: | 132 |
|---|
| Sequence: | MCDAFVGTWKLVSSENFDDYMKEVGVGFATRKVAGMAKPNLIISVEGDLVVIRSESTFKN
TEISFKLGVEFDEITPDDRKVKSIITLDGGVLVHVQKWDGKSTTIKKRRDGDKLVVECVM
KGVTSTRVYERA
|
|
|
|---|
| BDBM50381857 |
|---|
| n/a |
|---|
| Name | BDBM50381857 |
|---|
| Synonyms: | CHEMBL2023268 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C18H14FNO2 |
|---|
| Mol. Mass. | 295.3077 |
|---|
| SMILES | OC(=O)\C=C\c1cn(Cc2ccccc2F)c2ccccc12 |
|---|
| Structure | 
|
|---|
Search and Browse
