Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetMonoamine oxidase
LigandBDBM50381960
Substrate/Competitorn/a
Meas. Tech.ChEMBL_814868
IC50 0.79±n/a nM
Citation Samadi Ade los Ríos CBolea IChioua MIriepa IMoraleda IBartolini MAndrisano VGálvez EValderas CUnzeta MMarco-Contelles J Multipotent MAO and cholinesterase inhibitors for the treatment of Alzheimer's disease: synthesis, pharmacological analysis and molecular modeling of heterocyclic substituted alkyl and cycloalkyl propargyl amine. Eur J Med Chem 52:251-62 (2012) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Monoamine oxidase
Name:Monoamine oxidase
Synonyms:Amine oxidase (flavin-containing) A | Amine oxidase [flavin-containing] A | Monoamine Oxidase Type A (MAO-A) | Monoamine oxidase A (MAO-A) | Monoamine oxidase A (rMAO-A) | Monoamine oxidase type A (MAOA)
Type:Enzyme
Mol. Mass.:59515.21
Organism:Rattus norvegicus (rat)
Description:n/a
Residue:526
Sequence:
MTDLEKPNLAGHMFDVGLIGGGISGLAAAKLLSEYKINVLVLEARDRVGGRTYTVRNEHV
KWVDVGGAYVGPTQNRILRLSKELGIETYKVNVNERLVQYVKGKTYPFRGAFPPVWNPLA
YLDYNNLWRTMDEMGKEIPVDAPWQARHAQEWDKMTMKDLIDKICWTKTAREFAYLFVNI
NVTSEPHEVSALWFLWYVRQCGGTARIFSVTNGGQERKFVGGSGQVSEQIMGLLGDKVKL
SSPVTYIDQTDDNIIVETLNHEHYECKYVISAIPPILTAKIHFKPELPPERNQLIQRLPM
GAVIKCMVYYKEAFWKKKDYCGCMIIEDEEAPIAITLDDTKPDGSLPAIMGFILARKADR
QAKLHKDIRKRKICELYAKVLGSQEALYPVHYEEKNWCEEQYSGGCYTAYFPPGIMTQYG
RVIRQPVGRIYFAGTETATQWSGYMEGAVEAGERAAREVLNALGKVAKKDIWVEEPESKD
VPAIEITHTFLERNLPSVPGLLKITGVSTSVALLCFVLYKIKKLPC
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50381960
n/a
NameBDBM50381960
Synonyms:CHEMBL2022927
TypeSmall organic molecule
Emp. Form.C20H20N2O
Mol. Mass.304.3856
SMILESCN(CC#C)Cc1cc2cc(OCc3ccccc3)ccc2[nH]1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: