Reaction Details |
| Report a problem with these data |
Target | Sigma non-opioid intracellular receptor 1 |
---|
Ligand | BDBM50382166 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_816069 (CHEMBL2026918) |
---|
IC50 | 0.27±n/a nM |
---|
Citation | Riganas, S; Papanastasiou, I; Foscolos, GB; Tsotinis, A; Bourguignon, JJ; Serin, G; Mirjolet, JF; Dimas, K; Kourafalos, VN; Eleutheriades, A; Moutsos, VI; Khan, H; Georgakopoulou, S; Zaniou, A; Prassa, M; Theodoropoulou, M; Pondiki, S; Vamvakides, A Synthesis,s1,s2-receptors binding affinity and antiproliferative action of new C1-substituted adamantanes. Bioorg Med Chem20:3323-31 (2012) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Sigma non-opioid intracellular receptor 1 |
---|
Name: | Sigma non-opioid intracellular receptor 1 |
Synonyms: | Aging-associated gene 8 protein | OPRS1 | SGMR1_HUMAN | SIG-1R | SIGMAR1 | SR-BP | SR31747-binding protein | SRBP | Sigma 1-type opioid receptor | Sigma opioid receptor | Sigma1R | hSigmaR1 |
Type: | Enzyme Catalytic Domain |
Mol. Mass.: | 25124.85 |
Organism: | Homo sapiens (Human) |
Description: | Q99720 |
Residue: | 223 |
Sequence: | MQWAVGRRWAWAALLLAVAAVLTQVVWLWLGTQSFVFQREEIAQLARQYAGLDHELAFSR
LIVELRRLHPGHVLPDEELQWVFVNAGGWMGAMCLLHASLSEYVLLFGTALGSRGHSGRY
WAEISDTIISGTFHQWREGTTKSEVFYPGETVVHGPGEATAVEWGPNTWMVEYGRGVIPS
TLAFALADTVFSTQDFLTLFYTLRSYARGLRLELTTYLFGQDP
|
|
|
BDBM50382166 |
---|
n/a |
---|
Name | BDBM50382166 |
Synonyms: | CHEMBL2023825 |
Type | Small organic molecule |
Emp. Form. | C33H44N2 |
Mol. Mass. | 468.7159 |
SMILES | C1CCC(CC1)N1CCN(CC1)c1ccc(cc1)C(c1ccccc1)C12CC3CC(CC(C3)C1)C2 |TLB:18:25:28.27.32:30,THB:26:27:30:34.25.33,26:25:28.27.32:30,33:25:28:32.31.30,33:31:28:34.26.25,18:25:28:32.31.30| |
Structure |
|