| Reaction Details |
|---|
 | Report a problem with these data |
| Target | TGF-beta receptor type-1 |
|---|
| Ligand | BDBM50382319 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_815895 (CHEMBL2026330) |
|---|
| IC50 | 4±n/a nM |
|---|
| Citation |  Boys, ML; Bian, F; Kramer, JB; Chio, CL; Ren, XD; Chen, H; Barrett, SD; Sexton, KE; Iula, DM; Filzen, GF; Nguyen, MN; Angell, P; Downs, VL; Wang, Z; Raheja, N; Ellsworth, EL; Fakhoury, S; Bratton, LD; Keller, PR; Gowan, R; Drummond, EM; Maiti, SN; Hena, MA; Lu, L; McConnell, P; Knafels, JD; Thanabal, V; Sun, F; Alessi, D; McCarthy, A; Zhang, E; Finzel, BC; Patel, S; Ciotti, SM; Eisma, R; Payne, NA; Gilbertsen, RB; Kostlan, CR; Pocalyko, DJ; Lala, DS Discovery of a series of 2-(1H-pyrazol-1-yl)pyridines as ALK5 inhibitors with potential utility in the prevention of dermal scarring. Bioorg Med Chem Lett22:3392-7 (2012) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| TGF-beta receptor type-1 |
|---|
| Name: | TGF-beta receptor type-1 |
|---|
| Synonyms: | ALK-5 | ALK5 | Activin A receptor type II-like protein kinase of 53kD | Activin receptor-like kinase 5 | SKR4 | Serine/threonine-protein kinase receptor R4 | TGF-beta receptor type I | TGF-beta type I receptor | TGFBR1 | TGFR-1 | TGFR1_HUMAN | TbetaR-I | Transforming growth factor-beta receptor type I |
|---|
| Type: | enzyme |
|---|
| Mol. Mass.: | 55968.24 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P36897 |
|---|
| Residue: | 503 |
|---|
| Sequence: | MEAAVAAPRPRLLLLVLAAAAAAAAALLPGATALQCFCHLCTKDNFTCVTDGLCFVSVTE
TTDKVIHNSMCIAEIDLIPRDRPFVCAPSSKTGSVTTTYCCNQDHCNKIELPTTVKSSPG
LGPVELAAVIAGPVCFVCISLMLMVYICHNRTVIHHRVPNEEDPSLDRPFISEGTTLKDL
IYDMTTSGSGSGLPLLVQRTIARTIVLQESIGKGRFGEVWRGKWRGEEVAVKIFSSREER
SWFREAEIYQTVMLRHENILGFIAADNKDNGTWTQLWLVSDYHEHGSLFDYLNRYTVTVE
GMIKLALSTASGLAHLHMEIVGTQGKPAIAHRDLKSKNILVKKNGTCCIADLGLAVRHDS
ATDTIDIAPNHRVGTKRYMAPEVLDDSINMKHFESFKRADIYAMGLVFWEIARRCSIGGI
HEDYQLPYYDLVPSDPSVEEMRKVVCEQKLRPNIPNRWQSCEALRVMAKIMRECWYANGA
ARLTALRIKKTLSQLSQQEGIKM
|
|
|
|---|
| BDBM50382319 |
|---|
| n/a |
|---|
| Name | BDBM50382319 |
|---|
| Synonyms: | CHEMBL2024686 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C19H17N5O |
|---|
| Mol. Mass. | 331.3712 |
|---|
| SMILES | Cc1cnn(c1-c1ccc2ncn(C)c(=O)c2c1)-c1cccc(C)n1 |
|---|
| Structure | 
|
|---|
Search and Browse
