BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetHydroxyacid oxidase 1
LigandBDBM50382412
Substrate/Competitorn/a
Meas. Tech.ChEMBL_815423
IC50 45700±n/a nM
Citation Barawkar DAMeru ABandyopadhyay ABanerjee ADeshpande AMAthare CKoduru CKhose GGundu JMahajan KPatil PKandalkar SRNiranjan SBhosale SDe SMukhopadhyay SChaudhary SKoul SSingh UChugh APalle VPMookhtiar KAVacca JChakravarty PKNargund RPWright SDRoy SGraziano MPSingh SBCully DCai TQ Potent and Selective Inhibitors of Long Chain l-2-Hydroxy Acid Oxidase Reduced Blood Pressure in DOCA Salt-Treated Rats. ACS Med Chem Lett 2:919-923 (2011) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Hydroxyacid oxidase 1
Name:Hydroxyacid oxidase 1
Synonyms:Hao1 | Hao1_mapped | Hydroxyacid oxidase 1 (Mapped) | Protein Hao1
Type:PROTEIN
Mol. Mass.:40969.82
Organism:Rattus norvegicus
Description:ChEMBL_815423
Residue:370
Sequence:
MLPRLVCISDYEQHARTVLQKSVYDYYKSGANDQETLADNIRAFSRWKLYPRMLRNVADI
DLSTSVLGQRVSMPICVGATAMQCMAHVDGELATVRACQTMGTGMMLSSWATSSIEEVAE
AGPEALRWMQLYIYKDREVSSQLVKRAEQMGYKAIFVTVDTPYLGNRFDDVRNRFKLPPQ
LRMKNFETNDLAFSPKGNFGDNSGLAEYVAQAIDPSLSWDDIKWLRRLTSLPIVVKGILR
GDDAQEAVKHGVDGILVSNHGARQLDGVPATIDALPEIVEAVEGKVEVFLDGGVRKGTDV
LKALALGARAVFVGRPIIWGLAFQGEKGVQDVLEILKEEFRLAMALSGCQNVKVIDKTLV
RKNPLAVSKI
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50382412
n/a
NameBDBM50382412
Synonyms:CHEMBL2022570
TypeSmall organic molecule
Emp. Form.C18H15FN2O2
Mol. Mass.310.3223
SMILESCc1[nH]nc(C(O)=O)c1Cc1cccc(c1)-c1ccc(F)cc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: