Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetKinesin-like protein 1
LigandBDBM50382559
Substrate/Competitorn/a
Meas. Tech.ChEMBL_816346
Ki 2.5±n/a nM
Citation Wang FGood JARath OKaan HYSutcliffe OBMackay SPKozielski F Triphenylbutanamines: kinesin spindle protein inhibitors with in vivo antitumor activity. J Med Chem 55:1511-25 (2012) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Kinesin-like protein 1
Name:Kinesin-like protein 1
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:119138.97
Organism:Homo sapiens (Human)
Description:ChEMBL_1457426
Residue:1056
Sequence:
MASQPNSSAKKKEEKGKNIQVVVRCRPFNLAERKASAHSIVECDPVRKEVSVRTGGLADK
SSRKTYTFDMVFGASTKQIDVYRSVVCPILDEVIMGYNCTIFAYGQTGTGKTFTMEGERS
PNEEYTWEEDPLAGIIPRTLHQIFEKLTDNGTEFSVKVSLLEIYNEELFDLLNPSSDVSE
RLQMFDDPRNKRGVIIKGLEEITVHNKDEVYQILEKGAAKRTTAATLMNAYSSRSHSVFS
VTIHMKETTIDGEELVKIGKLNLVDLAGSENIGRSGAVDKRAREAGNINQSLLTLGRVIT
ALVERTPHVPYRESKLTRILQDSLGGRTRTSIIATISPASLNLEETLSTLEYAHRAKNIL
NKPEVNQKLTKKALIKEYTEEIERLKRDLAAAREKNGVYISEENFRVMSGKLTVQEEQIV
ELIEKIGAVEEELNRVTELFMDNKNELDQCKSDLQNKTQELETTQKHLQETKLQLVKEEY
ITSALESTEEKLHDAASKLLNTVEETTKDVSGLHSKLDRKKAVDQHNAEAQDIFGKNLNS
LFNNMEELIKDGSSKQKAMLEVHKTLFGNLLSSSVSALDTITTVALGSLTSIPENVSTHV
SQIFNMILKEQSLAAESKTVLQELINVLKTDLLSSLEMILSPTVVSILKINSQLKHIFKT
SLTVADKIEDQKKELDGFLSILCNNLHELQENTICSLVESQKQCGNLTEDLKTIKQTHSQ
ELCKLMNLWTERFCALEEKCENIQKPLSSVQENIQQKSKDIVNKMTFHSQKFCADSDGFS
QELRNFNQEGTKLVEESVKHSDKLNGNLEKISQETEQRCESLNTRTVYFSEQWVSSLNER
EQELHNLLEVVSQCCEASSSDITEKSDGRKAAHEKQHNIFLDQMTIDEDKLIAQNLELNE
TIKIGLTKLNCFLEQDLKLDIPTGTTPQRKSYLYPSTLVRTEPREHLLDQLKRKQPELLM
MLNCSENNKEETIPDVDVEEAVLGQYTEEPLSQEPSVDAGVDCSSIGGVPFFQHKKSHGK
DKENRGINTLERSKVEETTEHLVTKSRLPLRAQINL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50382559
n/a
NameBDBM50382559
Synonyms:ISPINESIB
TypeSmall organic molecule
Emp. Form.C30H33ClN4O2
Mol. Mass.517.062
SMILESCC(C)[C@@H](N(CCCN)C(=O)c1ccc(C)cc1)c1nc2cc(Cl)ccc2c(=O)n1Cc1ccccc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: