Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetLysosomal Pro-X carboxypeptidase
LigandBDBM50382904
Substrate/Competitorn/a
Meas. Tech.ChEMBL_815280
IC50 1±n/a nM
Citation Graham THLiu WVerras ASebhat IKXiong YBleasby KBhatt URChen QGarcia-Calvo MGeissler WMGorski JNHe HLassman MELisnock JLi XShen ZTong XTung ECWiltsie JXiao JXie DXu SHale JJPinto SShen DM A new class of prolylcarboxypeptidase inhibitors, part 1: discovery and evaluation. Bioorg Med Chem Lett 22:2811-7 (2012) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Lysosomal Pro-X carboxypeptidase
Name:Lysosomal Pro-X carboxypeptidase
Synonyms:PRCP | Proline carboxypeptidase | Prolylcarboxypeptidase
Type:PROTEIN
Mol. Mass.:55028.96
Organism:Mus musculus
Description:ChEMBL_1335505
Residue:491
Sequence:
MGCRALLLLSFLLLGAATTIPPRLKTLGSPHLSASPTPDPAVARKYSVLYFEQKVDHFGF
ADMRTFKQRYLVADKHWQRNGGSILFYTGNEGDIVWFCNNTGFMWDVAEELKAMLVFAEH
RYYGESLPFGQDSFKDSQHLNFLTSEQALADFAELIRHLEKTIPGAQGQPVIAIGGSYGG
MLAAWFRMKYPHIVVGALAASAPIWQLDGMVPCGEFMKIVTNDFRKSGPYCSESIRKSWN
VIDKLSGSGSGLQSLTNILHLCSPLTSEKIPTLKGWIAETWVNLAMVNYPYACNFLQPLP
AWPIKEVCQYLKNPNVSDTVLLQNIFQALSVYYNYSGQAACLNISQTTTSSLGSMGWSFQ
ACTEMVMPFCTNGIDDMFEPFLWDLEKYSNDCFNQWGVKPRPHWMTTMYGGKNISSHSNI
IFSNGELDPWSGGGVTRDITDTLVAINIHDGAHHLDLRAHNAFDPSSVLLSRLLEVKHMK
KWILDFYSNIQ
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50382904
n/a
NameBDBM50382904
Synonyms:CHEMBL2022793
TypeSmall organic molecule
Emp. Form.C30H34Cl2F2N4O
Mol. Mass.575.52
SMILESCc1cc(C2CCN(CC2)C(=O)[C@@H]2CN(C[C@H]2c2ccc(F)cc2F)C(C)(C)C)n(n1)-c1ccc(Cl)c(Cl)c1 |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: