Reaction Details |
| Report a problem with these data |
Target | IGF-like family receptor 1 |
---|
Ligand | BDBM50382959 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_817987 (CHEMBL2033413) |
---|
Kd | >10000±n/a nM |
---|
Citation | Rowbottom, MW; Faraoni, R; Chao, Q; Campbell, BT; Lai, AG; Setti, E; Ezawa, M; Sprankle, KG; Abraham, S; Tran, L; Struss, B; Gibney, M; Armstrong, RC; Gunawardane, RN; Nepomuceno, RR; Valenta, I; Hua, H; Gardner, MF; Cramer, MD; Gitnick, D; Insko, DE; Apuy, JL; Jones-Bolin, S; Ghose, AK; Herbertz, T; Ator, MA; Dorsey, BD; Ruggeri, B; Williams, M; Bhagwat, S; James, J; Holladay, MW Identification of 1-(3-(6,7-dimethoxyquinazolin-4-yloxy)phenyl)-3-(5-(1,1,1-trifluoro-2-methylpropan-2-yl)isoxazol-3-yl)urea hydrochloride (CEP-32496), a highly potent and orally efficacious inhibitor of V-RAF murine sarcoma viral oncogene homologue B1 (BRAF) V600E. J Med Chem55:1082-105 (2012) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
IGF-like family receptor 1 |
---|
Name: | IGF-like family receptor 1 |
Synonyms: | IGFLR1 | IGFR1_HUMAN | TMEM149 | Transmembrane protein 149 | U2 small nuclear RNA auxiliary factor 1-like 4 | U2AF1L4 |
Type: | PROTEIN |
Mol. Mass.: | 37897.21 |
Organism: | Homo sapiens (Human) |
Description: | ChEMBL_1510617 |
Residue: | 355 |
Sequence: | MGPGRCLLTALLLLALAPPPEASQYCGRLEYWNPDNKCCSSCLQRFGPPPCPDYEFRENC
GLNDHGDFVTPPFRKCSSGQCNPDGAELCSPCGGGAVTPTPAAGGGRTPWRCRERPVPAK
GHCPLTPGNPGAPSSQERSSPASSIAWRTPEPVPQQAWPNFLPLVVLVLLLTLAVIAILL
FILLWHLCWPKEKADPYPYPGLVCGVPNTHTPSSSHLSSPGALETGDTWKEASLLPLLSR
ELSSLASQPLSRLLDELEVLEELIVLLDPEPGPGGGMAHGTTRHLAARYGLPAAWSTFAY
SLRPSRSPLRALIEMVVAREPSASLGQLGTHLAQLGRADALRVLSKLGSSGVCWA
|
|
|
BDBM50382959 |
---|
n/a |
---|
Name | BDBM50382959 |
Synonyms: | CEP-32496 | CHEMBL2029988 | US9730937, Example 261 |
Type | Small organic molecule |
Emp. Form. | C24H22F3N5O5 |
Mol. Mass. | 517.4572 |
SMILES | COc1cc2ncnc(Oc3cccc(NC(=O)Nc4cc(on4)C(C)(C)C(F)(F)F)c3)c2cc1OC |
Structure |
|