Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetHistamine H2 Receptor
LigandBDBM50158610
Substrate/Competitorn/a
Meas. Tech.ChEMBL_818794
Ki 1708±n/a nM
Citation Bao XLu SLiow JSZoghbi SSJenko KJClark DTGladding RLInnis RBPike VW Radiosynthesis and evaluation of an (18)F-labeled positron emission tomography (PET) radioligand for brain histamine subtype-3 receptors based on a nonimidazole 2-aminoethylbenzofuran chemotype. J Med Chem 55:2406-15 (2012) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Histamine H2 Receptor
Name:Histamine H2 receptor
Synonyms:Gastric receptor I | H2R | HISTAMINE H2 | Histamine H2-Gs alpha S
Type:G Protein-Coupled Receptor (GPCR)
Mol. Mass.:40115.31
Organism:Homo sapiens (Human)
Description:n/a
Residue:359
Sequence:
MAPNGTASSFCLDSTACKITITVVLAVLILITVAGNVVVCLAVGLNRRLRNLTNCFIVSL
AITDLLLGLLVLPFSAIYQLSCKWSFGKVFCNIYTSLDVMLCTASILNLFMISLDRYCAV
MDPLRYPVLVTPVRVAISLVLIWVISITLSFLSIHLGWNSRNETSKGNHTTSKCKVQVNE
VYGLVDGLVTFYLPLLIMCITYYRIFKVARDQAKRINHISSWKAATIREHKATVTLAAVM
GAFIICWFPYFTAFVYRGLRGDDAINEVLEAIVLWLGYANSALNPILYAALNRDFRTGYQ
QLFCCRLANRNSHKTSLRSNASQLSRTQSREPRQQEEKPLKLQVWSGTEVTAPQGATDR
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50158610
n/a
NameBDBM50158610
Synonyms:(4-Fluoro-phenyl)-{2-[2-((R)-2-methyl-pyrrolidin-1-yl)-ethyl]-benzofuran-5-yl}-methanone | CHEMBL555146
TypeSmall organic molecule
Emp. Form.C22H22FNO2
Mol. Mass.351.414
SMILESC[C@@H]1CCCN1CCc1cc2cc(ccc2o1)C(=O)c1ccc(F)cc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: