Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetProlylcarboxypeptidase (PRCP)
LigandBDBM50382906
Substrate/Competitorn/a
Meas. Tech.ChEMBL_818259
IC50 0.3±n/a nM
Citation Graham THLiu WVerras AReibarkh MBleasby KBhatt URChen QGarcia-Calvo MGeissler WMGorski JNHe HLassman MELisnock JLi XShen ZTong XTung ECWiltsie JXie DXu SXiao JHale JJPinto SShen DM A new class of prolylcarboxypeptidase inhibitors, part 2: the aminocyclopentanes. Bioorg Med Chem Lett 22:2818-22 (2012) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Prolylcarboxypeptidase (PRCP)
Name:Lysosomal Pro-X carboxypeptidase
Synonyms:Angiotensinase C | Lysosomal carboxypeptidase C | PRCP | Proline carboxypeptidase | Prolylcarboxypeptidase
Type:Enzyme
Mol. Mass.:55805.19
Organism:Homo sapiens (Human)
Description:P42785
Residue:496
Sequence:
MGRRALLLLLLSFLAPWATIALRPALRALGSLHLPTNPTSLPAVAKNYSVLYFQQKVDHF
GFNTVKTFNQRYLVADKYWKKNGGSILFYTGNEGDIIWFCNNTGFMWDVAEELKAMLVFA
EHRYYGESLPFGDNSFKDSRHLNFLTSEQALADFAELIKHLKRTIPGAENQPVIAIGGSY
GGMLAAWFRMKYPHMVVGALAASAPIWQFEDLVPCGVFMKIVTTDFRKSGPHCSESIHRS
WDAINRLSNTGSGLQWLTGALHLCSPLTSQDIQHLKDWISETWVNLAMVDYPYASNFLQP
LPAWPIKVVCQYLKNPNVSDSLLLQNIFQALNVYYNYSGQVKCLNISETATSSLGTLGWS
YQACTEVVMPFCTNGVDDMFEPHSWNLKELSDDCFQQWGVRPRPSWITTMYGGKNISSHT
NIVFSNGELDPWSGGGVTKDITDTLVAVTISEGAHHLDLRTKNALDPMSVLLARSLEVRH
MKNWIRDFYDSAGKQH
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50382906
n/a
NameBDBM50382906
Synonyms:CHEMBL2023202
TypeSmall organic molecule
Emp. Form.C30H34Cl2F2N4O
Mol. Mass.575.52
SMILESCc1cc(C2CCN(CC2)C(=O)[C@@H]2CN(C[C@H]2c2ccc(F)cc2F)C(C)(C)C)n(n1)-c1cc(Cl)ccc1Cl |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: