| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Prostaglandin E2 receptor EP3 subtype |
|---|
| Ligand | BDBM50384445 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_821761 (CHEMBL2039058) |
|---|
| Ki | 7.94±n/a nM |
|---|
| Citation |  Jin, J; Morales-Ramos, A; Eidam, P; Mecom, J; Li, Y; Brooks, C; Hilfiker, M; Zhang, D; Wang, N; Shi, D; Tseng, PS; Wheless, K; Budzik, B; Evans, K; Jaworski, JP; Jugus, J; Leon, L; Wu, C; Pullen, M; Karamshi, B; Rao, P; Ward, E; Laping, N; Evans, C; Leach, C; Holt, D; Su, X; Morrow, D; Fries, H; Thorneloe, K; Edwards, R Novel 3-Oxazolidinedione-6-aryl-pyridinones as Potent, Selective, and Orally Active EP3 Receptor Antagonists. ACS Med Chem Lett1:316-320 (2010) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Prostaglandin E2 receptor EP3 subtype |
|---|
| Name: | Prostaglandin E2 receptor EP3 subtype |
|---|
| Synonyms: | PE2R3_RAT | PTGER2 | Prostaglandin E2 | Prostaglandin E2 receptor EP3 subtype | Prostanoid EP3 receptor | Ptger3 |
|---|
| Type: | Enzyme Catalytic Domain |
|---|
| Mol. Mass.: | 39958.37 |
|---|
| Organism: | RAT |
|---|
| Description: | Prostaglandin E2 PTGER2 RAT::P34980 |
|---|
| Residue: | 365 |
|---|
| Sequence: | MAGVWAPEHSVEAHSNQSSAADGCGSVSVAFPITMMVTGFVGNALAMLLVVRSYRRRESK
RKKSFLLCIGWLALTDLVGQLLTSPVVILVYLSQRRWEQLDPSGRLCTFFGLTMTVFGLS
SLLVASAMAVERALAIRAPHWYASHMKTRATPVLLGVWLSVLAFALLPVLGVGRYSVQWP
GTWCFISTGPAGNETDSAREPGSVAFASAFACLGLLALVVTFACNLATIKALVSRCRAKA
AASQSSAQWGRITTETAIQLMGIMCVLSVCWSPLLIMMLKMIFNQMSVEQCKTQMGKEKE
CNSFLIAVRLASLNQILDPWVYLLLRKILLRKFCQIRDHTNYASSSTSLPCPGSSVLMWS
DQLER
|
|
|
|---|
| BDBM50384445 |
|---|
| n/a |
|---|
| Name | BDBM50384445 |
|---|
| Synonyms: | CHEMBL2035508 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C20H19N3O4 |
|---|
| Mol. Mass. | 365.3826 |
|---|
| SMILES | CC(C)C1(OC(=O)NC1=O)c1ccc([nH]c1=O)-c1ccc2n(C)ccc2c1 |
|---|
| Structure | 
|
|---|
Search and Browse
