Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetIsoprenylcysteine carboxyl methyltransferase
LigandBDBM50384447
Substrate/Competitorn/a
Meas. Tech.ChEMBL_821764
IC50 2500±n/a nM
Citation Bergman JAHahne KSong JHrycyna CAGibbs RA S-Farnesyl-Thiopropionic Acid (FTPA) Triazoles as Potent Inhibitors of Isoprenylcysteine Carboxyl Methyltransferase. ACS Med Chem Lett 3:15-19 (2012) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Isoprenylcysteine carboxyl methyltransferase
Name:Isoprenylcysteine carboxyl methyltransferase
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:31943.26
Organism:Homo sapiens (Human)
Description:ChEMBL_956034
Residue:284
Sequence:
MAGCAARAPPGSEARLSLATFLLGASVLALPLLTRAGLQGRTGLALYVAGLNALLLLLYR
PPRYQIAIRACFLGFVFGCGTLLSFSQSSWSHFGWYMCSLSLFHYSEYLVTAVNNPKSLS
LDSFLLNHSLEYTVAALSSWLEFTLENIFWPELKQITWLSVTGLLMVVFGECLRKAAMFT
AGSNFNHVVQNEKSDTHTLVTSGVYAWFRHPSYVGWFYWSIGTQVMLCNPICGVSYALTV
WRFFRDRTEEEEISLIHFFGEEYLEYKKRVPTGLPFIKGVKVDL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50384447
n/a
NameBDBM50384447
Synonyms:CHEMBL2035745
TypeSmall organic molecule
Emp. Form.C38H39NO4S
Mol. Mass.605.786
SMILES[#6]\[#6](-[#6])=[#6]\[#6]\[#6](-[#6]-[#6]-c1ccc(cc1)-c1ccccc1)=[#6]/[#6]-[#16]-[#6]-[#6@H](-[#7]-[#6](=O)-c1ccccc1-[#8]-c1ccccc1)-[#6](-[#8])=O |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: