Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetRegulator of G-protein signaling 4 (RGS4)
LigandBDBM50384742
Substrate/Competitorn/a
Meas. Tech.ChEMBL_821035
IC50 52±n/a nM
Citation Turner EMBlazer LLNeubig RRHusbands SM Small Molecule Inhibitors of Regulator of G Protein Signalling (RGS) Proteins. ACS Med Chem Lett 3:146-150 (2012) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Regulator of G-protein signaling 4 (RGS4)
Name:Regulator of G-protein signaling 4 (RGS4)
Synonyms:RGP4 | RGS4
Type:Enzyme
Mol. Mass.:23263.51
Organism:Homo sapiens (Human)
Description:P49798
Residue:205
Sequence:
MCKGLAGLPASCLRSAKDMKHRLGFLLQKSDSCEHNSSHNKKDKVVICQRVSQEEVKKWA
ESLENLISHECGLAAFKAFLKSEYSEENIDFWISCEEYKKIKSPSKLSPKAKKIYNEFIS
VQATKEVNLDSCTREETSRNMLEPTITCFDEAQKKIFNLMEKDSYRRFLKSRFYLDLVNP
SSCGAEKQKGAKSSADCASLVPQCA
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50384742
n/a
NameBDBM50384742
Synonyms:CHEMBL2037233
TypeSmall organic molecule
Emp. Form.C15H10ClFN2O2S
Mol. Mass.336.769
SMILESFc1ccc(Cn2c(=O)sn(-c3cccc(Cl)c3)c2=O)cc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: